BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i06f (542 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41520.1 68418.m05044 40S ribosomal protein S10 (RPS10B) cont... 28 4.6 At4g35070.1 68417.m04978 expressed protein 27 6.1 At4g14280.1 68417.m02201 hypothetical protein 27 8.1 At1g73810.1 68414.m08546 expressed protein contains Pfam profile... 27 8.1 >At5g41520.1 68418.m05044 40S ribosomal protein S10 (RPS10B) contains similarity to 40S ribosomal protein S10 Length = 180 Score = 27.9 bits (59), Expect = 4.6 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -3 Query: 333 PAPDKADSRELGHPYFPGSD---GPDASTGGRRVPHVDSLRAGCRS 205 PA K + LG P+ G D GP G RR D R G +S Sbjct: 89 PATLKKQQKPLGRPFGGGGDRPRGPPRGDGERRFGDRDGYRGGPKS 134 >At4g35070.1 68417.m04978 expressed protein Length = 265 Score = 27.5 bits (58), Expect = 6.1 Identities = 12/46 (26%), Positives = 19/46 (41%) Frame = +3 Query: 321 CRGRGRFNFRHSPVQKLSTKRISLQCTDLGTLNLICPPVKHICICL 458 C G G N P +K+ C G ++ P +H+C C+ Sbjct: 197 CGGEGDGN--SLPAKKMKMSSCCCNCGSNGVTRVLFLPCRHLCCCM 240 >At4g14280.1 68417.m02201 hypothetical protein Length = 798 Score = 27.1 bits (57), Expect = 8.1 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = -1 Query: 296 TPTSRARTALTRLPAGAVYLTLTACELAVAARVTTKLRNSLSF 168 TP R T L +PA LTL A LAV ++ + L SL F Sbjct: 27 TPEPRRPTQLPPVPAPEKKLTLFALRLAVLEKIASGL-GSLGF 68 >At1g73810.1 68414.m08546 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266 Length = 418 Score = 27.1 bits (57), Expect = 8.1 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 297 VPVRDCPPCRGRGRFNFRHSPV 362 V V D P GRGR+N R SPV Sbjct: 262 VDVYDLPGPAGRGRYNRRMSPV 283 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,128,566 Number of Sequences: 28952 Number of extensions: 188492 Number of successful extensions: 396 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 396 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1013649368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -