BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i04r (714 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY623010-1|AAV41518.1| 94|Homo sapiens differentially placenta... 32 1.8 AY302185-1|AAP68818.1| 94|Homo sapiens replicative senescence ... 32 1.8 >AY623010-1|AAV41518.1| 94|Homo sapiens differentially placenta 1 expressed protein protein. Length = 94 Score = 32.3 bits (70), Expect = 1.8 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +1 Query: 373 C*FQHPRNGMVLSKNFSREAKLLKKYSFLVILFKTCSLIYFRYVLLSAR 519 C + N + + KN + + LL+ SFL+ ++ LIYF Y +L+ + Sbjct: 2 CFYGSKLNLLAIYKNVNSKLYLLRMSSFLIYIYTIVHLIYFFYTVLNTQ 50 >AY302185-1|AAP68818.1| 94|Homo sapiens replicative senescence upregulated protein protein. Length = 94 Score = 32.3 bits (70), Expect = 1.8 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +1 Query: 373 C*FQHPRNGMVLSKNFSREAKLLKKYSFLVILFKTCSLIYFRYVLLSAR 519 C + N + + KN + + LL+ SFL+ ++ LIYF Y +L+ + Sbjct: 2 CFYGSKLNLLAIYKNVNSKLYLLRMSSFLIYIYTIVHLIYFFYTVLNTQ 50 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,245,865 Number of Sequences: 237096 Number of extensions: 1542910 Number of successful extensions: 3313 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3066 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3311 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8343197486 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -