BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i03f (621 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.13c |mpd2||GYF domain|Schizosaccharomyces pombe|chr 1||... 27 1.7 SPBC21C3.20c |git1||C2 domain protein Git1|Schizosaccharomyces p... 25 8.8 >SPAC4F10.13c |mpd2||GYF domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 992 Score = 27.5 bits (58), Expect = 1.7 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = +3 Query: 333 RLDKERVVFI---NIPQDLDRPSRINEAQNPTTSNAASSANDIITEH 464 +LD +R + + N+ L+ PS + ++NPT S+ SSAN I + Sbjct: 65 KLDSQRKLSLKSGNMWDSLNAPSELT-SKNPTVSSTTSSANPAIVSN 110 >SPBC21C3.20c |git1||C2 domain protein Git1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1098 Score = 25.0 bits (52), Expect = 8.8 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -2 Query: 374 LGDVYKHHPFLI*TCDLSPWHTRPPRGVSCCRCWVYRRCLH 252 LGD++++ LI CD + W S + +RR L+ Sbjct: 399 LGDIFEYFFSLIHDCDYAIWSVHDEHQFSELLAFYHRRALN 439 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,343,477 Number of Sequences: 5004 Number of extensions: 44381 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 273658928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -