BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i03f (621 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 1.5 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 25 1.5 AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. 25 2.6 AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. 25 2.6 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 23 5.9 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 23 7.8 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 Query: 409 CASLIRLGRSKSWGMFINTTLSLSKRVTCRRG 314 C +R GRS+ W M TL + C RG Sbjct: 17 CLHPLRTGRSQGWYMHGRNTLRQMRWPPCYRG 48 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 25.4 bits (53), Expect = 1.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 606 RCLRTDRSVNLCTPPDRRRDCL 541 RC +TD C PDRR CL Sbjct: 433 RCWQTDHISQDCCGPDRRDCCL 454 >AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 24.6 bits (51), Expect = 2.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 430 AFDVVGFCASLIRLGRSKSWGM 365 +F +G CAS I++ SK W M Sbjct: 60 SFACIGRCASYIQVSGSKIWQM 81 >AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 24.6 bits (51), Expect = 2.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 430 AFDVVGFCASLIRLGRSKSWGM 365 +F +G CAS I++ SK W M Sbjct: 60 SFACIGRCASYIQVSGSKIWQM 81 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.4 bits (48), Expect = 5.9 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -3 Query: 490 LPPALSGN*CSVIISLADEAA--FDVVGFCASLIRL 389 L P G+ +I SLA+ A VVGFC S+I L Sbjct: 263 LGPEFGGS-IGLIFSLANAVACAMYVVGFCESMIDL 297 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 320 PWHTRPPRG 294 PWH RPP G Sbjct: 95 PWHPRPPFG 103 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 611,620 Number of Sequences: 2352 Number of extensions: 13040 Number of successful extensions: 20 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60214320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -