BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i02r (721 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0837 - 32328191-32328369,32328682-32328731,32328844-323289... 28 6.5 >01_06_0837 - 32328191-32328369,32328682-32328731,32328844-32328923, 32329193-32329345,32329505-32329654,32329877-32330000, 32330086-32330198,32330287-32330420,32330566-32331232 Length = 549 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 221 TTRIAPQMLFFCGCLFILHLCLIYIC-LKNKYFANAQMF*APKPHKNKNK 367 ++ +AP +FF GC I+ + + C L+++Y+ + F + N +K Sbjct: 132 SSHLAPVSVFFLGCALIVRDPIPFTCSLQHRYYGESMPFGSKDKAYNNSK 181 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,546,108 Number of Sequences: 37544 Number of extensions: 245793 Number of successful extensions: 326 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 324 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 326 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -