BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i02f (584 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g17310.2 68418.m02028 UTP--glucose-1-phosphate uridylyltransf... 123 8e-29 At3g03250.1 68416.m00321 UTP--glucose-1-phosphate uridylyltransf... 122 2e-28 At5g17310.1 68418.m02027 UTP--glucose-1-phosphate uridylyltransf... 56 2e-08 At3g27470.1 68416.m03433 expressed protein contains Pfam profile... 31 0.43 At3g23210.1 68416.m02926 basic helix-loop-helix (bHLH) family pr... 31 0.43 At1g15940.1 68414.m01913 expressed protein similar To androgen-i... 31 0.57 At1g71360.1 68414.m08237 expressed protein low similarity to PIR... 30 0.99 At1g61040.1 68414.m06872 plus-3 domain-containing protein contai... 30 0.99 At5g37370.2 68418.m04490 pre-mRNA splicing factor PRP38 family p... 29 2.3 At5g37370.1 68418.m04489 pre-mRNA splicing factor PRP38 family p... 29 2.3 At2g32950.1 68415.m04039 COP1 regulatory protein photomorphogene... 29 2.3 At4g16530.1 68417.m02502 expressed protein contains Pfam profile... 29 3.0 At5g52530.2 68418.m06518 dentin sialophosphoprotein-related cont... 28 4.0 At5g52530.1 68418.m06517 dentin sialophosphoprotein-related cont... 28 4.0 At3g46850.1 68416.m05085 subtilase family protein contains simil... 28 4.0 At4g32760.1 68417.m04661 VHS domain-containing protein / GAT dom... 28 5.3 At4g04740.1 68417.m00695 calcium-dependent protein kinase, putat... 28 5.3 At4g04710.1 68417.m00692 calcium-dependent protein kinase, putat... 28 5.3 At3g60930.1 68416.m06816 expressed protein 28 5.3 At4g21940.1 68417.m03174 calcium-dependent protein kinase, putat... 27 7.0 At4g04720.1 68417.m00693 calcium-dependent protein kinase, putat... 27 7.0 At2g01260.2 68415.m00039 expressed protein 27 7.0 At2g01260.1 68415.m00038 expressed protein 27 7.0 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 27 9.2 At1g78230.1 68414.m09116 leucine-rich repeat family protein 27 9.2 At1g31070.2 68414.m03804 UDP-N-acetylglucosamine pyrophosphoryla... 27 9.2 At1g01810.1 68414.m00100 hypothetical protein 27 9.2 >At5g17310.2 68418.m02028 UTP--glucose-1-phosphate uridylyltransferase, putative / UDP-glucose pyrophosphorylase, putative / UGPase, putative strong similarity to SP|P19595 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (UDP-glucose pyrophosphorylase) (UDPGP) (UGPase) {Solanum tuberosum}; contains Pfam profile PF01704: UTP--glucose-1-phosphate uridylyltransferase Length = 470 Score = 123 bits (297), Expect = 8e-29 Identities = 60/113 (53%), Positives = 78/113 (69%), Gaps = 2/113 (1%) Frame = +2 Query: 251 EKEFKGFKTLFSRFLAEQGPSVTWEKIEKLPEGAVIDYNSLSTPTTD--NVHHMLDKLVV 424 E E GF L SR+L+ + + W KI+ + V+ Y+ ++ + D ++LDKLVV Sbjct: 24 ENEKSGFINLVSRYLSGEAQHIEWSKIQTPTDEIVVPYDKMANVSEDASETKYLLDKLVV 83 Query: 425 VKLNGGLGTSMGCKGPKSVIQVRNDLTFLDLTVQQIEHLNKTYKCNVPLVLMN 583 +KLNGGLGT+MGC GPKSVI+VR+ LTFLDL V QIE+LN Y C VPLVLMN Sbjct: 84 LKLNGGLGTTMGCTGPKSVIEVRDGLTFLDLIVIQIENLNNKYNCKVPLVLMN 136 >At3g03250.1 68416.m00321 UTP--glucose-1-phosphate uridylyltransferase, putative / UDP-glucose pyrophosphorylase, putative / UGPase, putative strong similarity to SP|P19595 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (UDP-glucose pyrophosphorylase) (UDPGP) (UGPase) {Solanum tuberosum}; contains Pfam profile PF01704: UTP--glucose-1-phosphate uridylyltransferase Length = 469 Score = 122 bits (294), Expect = 2e-28 Identities = 62/114 (54%), Positives = 80/114 (70%), Gaps = 3/114 (2%) Frame = +2 Query: 251 EKEFKGFKTLFSRFLAEQGPSVTWEKIEKLPEGAVIDYNSLSTPTTDNV---HHMLDKLV 421 E E GF +L SR+L+ + + W KI+ + V+ Y + TP + +V ++LDKLV Sbjct: 23 ESEKSGFISLVSRYLSGEAQHIEWSKIQTPTDEIVVPYEKM-TPVSQDVAETKNLLDKLV 81 Query: 422 VVKLNGGLGTSMGCKGPKSVIQVRNDLTFLDLTVQQIEHLNKTYKCNVPLVLMN 583 V+KLNGGLGT+MGC GPKSVI+VR+ LTFLDL V QIE+LN Y C VPLVLMN Sbjct: 82 VLKLNGGLGTTMGCTGPKSVIEVRDGLTFLDLIVIQIENLNNKYGCKVPLVLMN 135 >At5g17310.1 68418.m02027 UTP--glucose-1-phosphate uridylyltransferase, putative / UDP-glucose pyrophosphorylase, putative / UGPase, putative strong similarity to SP|P19595 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (UDP-glucose pyrophosphorylase) (UDPGP) (UGPase) {Solanum tuberosum}; contains Pfam profile PF01704: UTP--glucose-1-phosphate uridylyltransferase Length = 390 Score = 55.6 bits (128), Expect = 2e-08 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +2 Query: 473 KSVIQVRNDLTFLDLTVQQIEHLNKTYKCNVPLVLMN 583 +SVI+VR+ LTFLDL V QIE+LN Y C VPLVLMN Sbjct: 20 RSVIEVRDGLTFLDLIVIQIENLNNKYNCKVPLVLMN 56 >At3g27470.1 68416.m03433 expressed protein contains Pfam profile PF05212: Protein of unknown function (DUF707) Length = 398 Score = 31.5 bits (68), Expect = 0.43 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = -3 Query: 501 RSFRTWITDLGPLQPMDVPRPPLSFTTTNLSSIWCTLSVVGVDRLL*SITAPSGSF 334 R F +W + G D+P PP ++ T IW + + G +RL I P F Sbjct: 62 RLFGSWSSTKGLKLKNDIPDPPYNYNDT---KIWVSTNPRGAERLPPDIVTPESDF 114 >At3g23210.1 68416.m02926 basic helix-loop-helix (bHLH) family protein similar to hypothetical protein GB:CAB10220 from [Arabidopsis thaliana] Length = 320 Score = 31.5 bits (68), Expect = 0.43 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 235 GFRGRGDELLQLHLQSSEGITFGGLLEV 152 GFRG+ D+ HLQ +G F G++E+ Sbjct: 107 GFRGQNDDSAVPHLQQQQGQVFSGVVEI 134 >At1g15940.1 68414.m01913 expressed protein similar To androgen-induced prostate proliferative shutoff associated protein (GI:4559410) [Homo sapiens] Length = 990 Score = 31.1 bits (67), Expect = 0.57 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 44 CYQSLLSRLLHKEMKPETNDSDKKIRSHQRTPSGSRDFK 160 C + H ++KP+ N++D+KI Q PS S + K Sbjct: 256 CQSEFATTQAHNDVKPKDNEADEKISEGQVVPSDSLEDK 294 >At1g71360.1 68414.m08237 expressed protein low similarity to PIR|JC7185 chromosome 1 C1orf9 protein [Homo sapiens] Length = 459 Score = 30.3 bits (65), Expect = 0.99 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 6/60 (10%) Frame = +2 Query: 50 QSLLSRLLHKEMKPETNDSDKKIRSHQRTPSGSRDFKEATKRDAL------ARLEVELEK 211 +SL ++ KEM E + +K++ + + G ++ +E TK++A+ R+E ELEK Sbjct: 323 RSLKYGMIFKEMDLEASKREKEVETMRLEVEGMKEREENTKKEAMEMRKWRMRVETELEK 382 >At1g61040.1 68414.m06872 plus-3 domain-containing protein contains Pfam profile PF03126: Plus-3 domain Length = 643 Score = 30.3 bits (65), Expect = 0.99 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = +2 Query: 59 LSRLLHKEMKPETNDSDKKIRSHQRTPSGSRDFKEATKRDALA 187 L+ L K MK + + +K+R + SGSRDF +TKR LA Sbjct: 183 LNELRAKRMKQQDPAALRKLRDASKGGSGSRDF-SSTKRKPLA 224 >At5g37370.2 68418.m04490 pre-mRNA splicing factor PRP38 family protein (SRL1) contains Pfam profile PF03371: PRP38 family Length = 385 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 301 TGSVGNMGENREASRRSCNRL*QSVHANDGQRAPYARQVGGGEA*RRP 444 +GS G+M E + R + S+ + GQRAP+ G RRP Sbjct: 172 SGSTGDMTRGSEDTARRPPSVKASLSVSFGQRAPHRASTRGSSPVRRP 219 >At5g37370.1 68418.m04489 pre-mRNA splicing factor PRP38 family protein (SRL1) contains Pfam profile PF03371: PRP38 family Length = 393 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 301 TGSVGNMGENREASRRSCNRL*QSVHANDGQRAPYARQVGGGEA*RRP 444 +GS G+M E + R + S+ + GQRAP+ G RRP Sbjct: 180 SGSTGDMTRGSEDTARRPPSVKASLSVSFGQRAPHRASTRGSSPVRRP 227 >At2g32950.1 68415.m04039 COP1 regulatory protein photomorphogenesis repressor; identical to COP1 regulatory protein/FUSCA protein FUS1 GI:402685 SP:P43254 Length = 675 Score = 29.1 bits (62), Expect = 2.3 Identities = 20/81 (24%), Positives = 35/81 (43%) Frame = +2 Query: 17 LRGLKLCLCCYQSLLSRLLHKEMKPETNDSDKKIRSHQRTPSGSRDFKEATKRDALARLE 196 LR C CC Q L + L+ + R +T S F+EA +R ++ Sbjct: 80 LRNKSDCPCCSQHLTNNQLYPNFLLDKLLKKTSARHVSKTASPLDQFREALQRGCDVSIK 139 Query: 197 VELEKLISTAPETRRPQLEKE 259 E++ L++ E +R ++E Sbjct: 140 -EVDNLLTLLAERKRKMEQEE 159 >At4g16530.1 68417.m02502 expressed protein contains Pfam profile PF04510: Family of unknown function (DUF577) Length = 774 Score = 28.7 bits (61), Expect = 3.0 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = +2 Query: 101 DSDKKIRSHQRTPSGSRDFK--EATKRDALARLEVELEKLISTAPETR-RPQLEK 256 D+ +K+R + + K EA KRDA +RLEV L + AP R P+ EK Sbjct: 572 DNREKVRKAEEAAAREEQIKREEARKRDAESRLEV-LRNVRGLAPLKRASPEAEK 625 >At5g52530.2 68418.m06518 dentin sialophosphoprotein-related contains weak similarity to dentin sialophosphoprotein precursor (Dentin matrix protein-3) (DMP- 3) (Swiss-Prot:P97399) [Mus musculus] Length = 828 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = +2 Query: 80 EMKPETNDSDKKIRSHQRTPS---GSRDFKEATKRDALARLEVELEKLISTAPE 232 E + N SD + +PS GS+ +KE DA+ R + + +ST P+ Sbjct: 459 EKQAVVNMSDSHPKKGSSSPSRSFGSKPYKEVPSHDAIQRRRPDTYEEVSTGPD 512 >At5g52530.1 68418.m06517 dentin sialophosphoprotein-related contains weak similarity to dentin sialophosphoprotein precursor (Dentin matrix protein-3) (DMP- 3) (Swiss-Prot:P97399) [Mus musculus] Length = 828 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = +2 Query: 80 EMKPETNDSDKKIRSHQRTPS---GSRDFKEATKRDALARLEVELEKLISTAPE 232 E + N SD + +PS GS+ +KE DA+ R + + +ST P+ Sbjct: 459 EKQAVVNMSDSHPKKGSSSPSRSFGSKPYKEVPSHDAIQRRRPDTYEEVSTGPD 512 >At3g46850.1 68416.m05085 subtilase family protein contains similarity to prepro-cucumisin GI:807698 from [Cucumis melo]; Length = 736 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -2 Query: 202 LHLQSSEGITFGGLLEVTRP*RRPLVTANLFIGVV 98 L+LQ++ F GL E R R PL+ ++ IGV+ Sbjct: 108 LNLQTTTSWNFMGLKEGKRTKRNPLIESDTIIGVI 142 >At4g32760.1 68417.m04661 VHS domain-containing protein / GAT domain-containing protein weak similarity to hepatocyte growth factor-regulated tyrosine kinase substrate HRS isoform 2 [Homo sapiens] GI:9022389; contains Pfam profiles PF00790: VHS domain, PF03127: GAT domain Length = 838 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +2 Query: 8 FLILRGLKLCLCCYQSLLSRLLHKEMKPETNDSDKKIRSHQR 133 ++ L L+ C CCY SL L +E + + + K R R Sbjct: 35 YVSLCSLRFCFCCYLSLSLYLFERERERVNSKMEIKFRFFTR 76 >At4g04740.1 68417.m00695 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Lycopersicon esculentum] gi|19171502|emb|CAC87494 Length = 520 Score = 27.9 bits (59), Expect = 5.3 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +2 Query: 251 EKEFKGFKTLFSRFLAEQGPSVTWEKIE 334 E+E KG KTLF+ + ++T+E+++ Sbjct: 368 EEEIKGLKTLFANMDTNRSGTITYEQLQ 395 >At4g04710.1 68417.m00692 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 575 Score = 27.9 bits (59), Expect = 5.3 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +2 Query: 251 EKEFKGFKTLFSRFLAEQGPSVTWEKIE 334 E+E KG KT+F ++ S+T+E+++ Sbjct: 331 EEEIKGLKTMFENMDMDKSGSITYEELK 358 >At3g60930.1 68416.m06816 expressed protein Length = 798 Score = 27.9 bits (59), Expect = 5.3 Identities = 31/113 (27%), Positives = 45/113 (39%), Gaps = 1/113 (0%) Frame = +2 Query: 86 KPETNDSDKKIRSHQRTPSGSRDFKEATKRDALARLEVELEKLISTAPETRRPQLEKEFK 265 K E KK ++ P GS E + D AR + L +PE R + Sbjct: 134 KAEKKKRKKKKKAVMPNPPGSSMCTEQSLSDLKARFGLGAVTLRVPSPEER---ADSPPA 190 Query: 266 GFKTLFSRFLAEQGPSVTWEKIEKLPEGAVIDYN-SLSTPTTDNVHHMLDKLV 421 GF TL+ F + W I +L V Y +LS T ++ H+L L+ Sbjct: 191 GFYTLYEGFFY---GCLLWLPIPRLVLEYVTSYQIALSQITMRSLRHLLGILI 240 >At4g21940.1 68417.m03174 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423 Length = 554 Score = 27.5 bits (58), Expect = 7.0 Identities = 9/28 (32%), Positives = 20/28 (71%) Frame = +2 Query: 251 EKEFKGFKTLFSRFLAEQGPSVTWEKIE 334 E+E KG KT+F+ ++ ++T+E+++ Sbjct: 401 EEEIKGLKTMFANMDTDKSGTITYEELK 428 >At4g04720.1 68417.m00693 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase(CDPK) [Carrot] SWISS-PROT:P28582 Length = 531 Score = 27.5 bits (58), Expect = 7.0 Identities = 9/28 (32%), Positives = 20/28 (71%) Frame = +2 Query: 251 EKEFKGFKTLFSRFLAEQGPSVTWEKIE 334 E+E KG KT+F+ ++ ++T+E+++ Sbjct: 379 EEEIKGLKTMFANIDTDKSGTITYEELK 406 >At2g01260.2 68415.m00039 expressed protein Length = 324 Score = 27.5 bits (58), Expect = 7.0 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 4/76 (5%) Frame = +2 Query: 158 KEATKR-DALARLEVELEKLISTAPETRRPQLEKEFKGFKTLFSRFLAEQGPSVTWEKIE 334 + A +R D L R + ++ + S+AP + QLE L RFL PSV + + Sbjct: 25 RRANQRIDQLRRAQSDVSNVPSSAPSPHKQQLEPSDLSSSNL-DRFLESVTPSVPAQFLS 83 Query: 335 KL---PEGAVIDYNSL 373 K A DYN L Sbjct: 84 KTLLRERRADDDYNKL 99 >At2g01260.1 68415.m00038 expressed protein Length = 369 Score = 27.5 bits (58), Expect = 7.0 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 4/76 (5%) Frame = +2 Query: 158 KEATKR-DALARLEVELEKLISTAPETRRPQLEKEFKGFKTLFSRFLAEQGPSVTWEKIE 334 + A +R D L R + ++ + S+AP + QLE L RFL PSV + + Sbjct: 25 RRANQRIDQLRRAQSDVSNVPSSAPSPHKQQLEPSDLSSSNL-DRFLESVTPSVPAQFLS 83 Query: 335 KL---PEGAVIDYNSL 373 K A DYN L Sbjct: 84 KTLLRERRADDDYNKL 99 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = -1 Query: 509 GRSGHSGLGSPIWGPYSPWMYPGLR*ASPPPTCRAYGARCPS 384 G G G G+P PY PG S P + ++GA+ PS Sbjct: 258 GYGGFGGYGNPAGAPYGNPSVPGAGFGSGPRS--SWGAQAPS 297 >At1g78230.1 68414.m09116 leucine-rich repeat family protein Length = 676 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 288 LLKSVLKPLNSFSSCGRL 235 LL SV PL+ FS CGRL Sbjct: 18 LLSSVFCPLSLFSGCGRL 35 >At1g31070.2 68414.m03804 UDP-N-acetylglucosamine pyrophosphorylase-related low similarity to SP|P43123 UDP-N-acetylglucosamine pyrophosphorylase (EC 2.7.7.23) {Saccharomyces cerevisiae} Length = 505 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 413 KLVVVKLNGGLGTSMGCKGPKSVIQV 490 KL VV L+GG GT +G PK + Sbjct: 128 KLGVVLLSGGQGTRLGSSDPKGCFNI 153 >At1g01810.1 68414.m00100 hypothetical protein Length = 160 Score = 27.1 bits (57), Expect = 9.2 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 4/91 (4%) Frame = +2 Query: 110 KKIRSHQRTPSGSRDFKEATKRDALARLEVELEKLISTAPETRRPQLEKEF----KGFKT 277 +K +SH+R + RD K+ K+D+ ++ +I T PET +L + F K FK Sbjct: 62 RKEKSHRRRETRKRDKKKKKKKDSNNNTKL----VIGTKPET-DAELRRWFSYFDKSFKL 116 Query: 278 LFSRFLAEQGPSVTWEKIEKLPEGAVIDYNS 370 R + P + + L E + + N+ Sbjct: 117 SLPRKVKLTSPRKLNDHNKNLKEAPICELNT 147 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,044,029 Number of Sequences: 28952 Number of extensions: 289357 Number of successful extensions: 1056 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 1005 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1051 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -