BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i01r (672 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0214 + 12713865-12713973,12715780-12716011,12716556-127166... 31 1.1 12_01_0676 + 5765154-5765241,5765329-5765453,5765533-5765604,576... 30 1.9 08_01_0706 - 6235817-6235988,6236028-6236338,6236421-6236627,623... 30 1.9 03_01_0185 - 1485023-1485733 29 4.5 02_05_0769 + 31616644-31616875,31616980-31617203,31617308-316174... 29 4.5 01_06_1648 - 38897268-38897480,38897816-38897884,38899712-38900038 28 5.9 >04_03_0214 + 12713865-12713973,12715780-12716011,12716556-12716635, 12716930-12717083,12717213-12717291,12717654-12717738, 12718420-12718466,12720123-12720281 Length = 314 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/68 (27%), Positives = 34/68 (50%) Frame = -3 Query: 211 QDFLACGVENNLLTEDYHVVGHQQLINTLSPGAVLQSEIESWPHWLDNARKVLG*YFIYT 32 Q LA + +NLL+ + ++N+L PGAV + + W L A + +G YF+ Sbjct: 201 QSKLANILHSNLLSSHLKEQDAKVIVNSLHPGAVATNILHHWCP-LYGAIRAIGKYFVKG 259 Query: 31 TNRSSITI 8 + + T+ Sbjct: 260 VEQGAATV 267 >12_01_0676 + 5765154-5765241,5765329-5765453,5765533-5765604, 5765728-5765802,5765880-5765905,5766709-5766870, 5766963-5767037,5767133-5767204,5767289-5767363, 5767461-5767529,5767839-5767910,5768030-5768161, 5768430-5768920,5769315-5769476,5769570-5769709, 5769818-5770037,5770398-5770633,5771560-5772051 Length = 927 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 5/37 (13%) Frame = -3 Query: 151 GHQQLINTLSPGAVLQSEIESWP----HW-LDNARKV 56 GH LI PG +LQ E+E WP HW L+ A K+ Sbjct: 85 GHSVLIRIAVPGLILQQELE-WPPSFNHWNLEQAPKL 120 >08_01_0706 - 6235817-6235988,6236028-6236338,6236421-6236627, 6236718-6236889,6236994-6237249,6238015-6238073, 6238693-6238782,6238869-6239013,6239598-6239712, 6240690-6240701 Length = 512 Score = 29.9 bits (64), Expect = 1.9 Identities = 25/104 (24%), Positives = 41/104 (39%), Gaps = 6/104 (5%) Frame = -3 Query: 373 GYSFV---AGGNGKIYEGAGWNHIGAHTLHYNNISIGIGFIG--DFREKLPTQQALQAVQ 209 GYSFV GG G+I+ G W Y ++S I G D+ + Q A Sbjct: 387 GYSFVNCSIGGTGRIWLGRAWRPYSTVVFAYTSMSDIIASEGWNDWNDPSRDQYASSLYS 446 Query: 208 -DFLACGVENNLLTEDYHVVGHQQLINTLSPGAVLQSEIESWPH 80 + C + + +Y G ++ P A S+++ P+ Sbjct: 447 VSIVTCMTKRTVFYGEYRCTGDGANLSDRVPYAQKLSDVQVLPY 490 >03_01_0185 - 1485023-1485733 Length = 236 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 430 LSVNSLRQHHMLLAGFKDLGYSFVAG 353 LS+NS R HH++L F D+ AG Sbjct: 187 LSLNSSRHHHLILRAFADVCEELFAG 212 >02_05_0769 + 31616644-31616875,31616980-31617203,31617308-31617426, 31617528-31617684,31617928-31618029,31618111-31618230, 31618761-31618855,31619900-31619984,31620090-31620180, 31620534-31620618,31620702-31620806,31621019-31621894, 31622016-31622124,31622266-31622414,31622518-31622737 Length = 922 Score = 28.7 bits (61), Expect = 4.5 Identities = 20/83 (24%), Positives = 34/83 (40%) Frame = +3 Query: 405 CCRREFTLSKHSSSVKQSLDTVCCITTKSIGLFRGCLRRDSVPLHSVMGISPHSDAKVDN 584 C F K +S V+ L CC T+ +GL SV + + +SP S Sbjct: 17 CTGANFGFEKRTSKVRFVLVGRCCSGTRKLGLVCASNSHSSVMEPAQLPLSPESGNTPKK 76 Query: 585 PAHVATMIKNRILFIVNKRSAFT 653 + A ++ + N+++ FT Sbjct: 77 SSESALILIRHGESLWNEKNLFT 99 >01_06_1648 - 38897268-38897480,38897816-38897884,38899712-38900038 Length = 202 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 637 LFTMNSILFLIIVATCAGLSTFASECGEI 551 LF ++L ++ V CAGL+ F E G+I Sbjct: 163 LFVPVTVLVIVAVCACAGLAIFCFEEGQI 191 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,908,628 Number of Sequences: 37544 Number of extensions: 422492 Number of successful extensions: 1055 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1035 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1055 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -