BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h24f (429 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) 188 2e-48 SB_973| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.019 SB_41532| Best HMM Match : Extensin_2 (HMM E-Value=1.4) 29 2.2 SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) 27 8.7 SB_10952| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-08) 27 8.7 SB_43935| Best HMM Match : 7tm_1 (HMM E-Value=0) 27 8.7 >SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) Length = 289 Score = 188 bits (457), Expect = 2e-48 Identities = 85/98 (86%), Positives = 92/98 (93%) Frame = +2 Query: 44 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 223 MT+KR NGGR+KHGRGHVK VRCTNCARCVPKDK+IKKFVIRNIVEAAAVRDI DASVY Sbjct: 1 MTKKRCNGGRSKHGRGHVKFVRCTNCARCVPKDKSIKKFVIRNIVEAAAVRDIADASVYE 60 Query: 224 MFQLPKLYAKLHYCVSCAIHSKVVRNRSKKDRRIRTPP 337 ++ LPKLY KLHYCVSCAIHSKVVRNRSK+DR+IRTPP Sbjct: 61 VYALPKLYVKLHYCVSCAIHSKVVRNRSKEDRKIRTPP 98 >SB_973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 35.5 bits (78), Expect = 0.019 Identities = 29/77 (37%), Positives = 39/77 (50%), Gaps = 7/77 (9%) Frame = +2 Query: 119 CAR-CVPKDKAIKKFVIRNIVEAAAVRD--INDASVYPMFQLPKLYAKLHYC--VS--CA 277 C R C+ +D+ I FVI AAAVRD + D ++Y + C VS C Sbjct: 664 CERDCIMRDRTICDFVICG--RAAAVRDCIMRDRAIYNCVMSDRFIRDCVMCDRVSRDCL 721 Query: 278 IHSKVVRNRSKKDRRIR 328 IH +VVR+ +DR IR Sbjct: 722 IHDRVVRDCVMRDRVIR 738 >SB_41532| Best HMM Match : Extensin_2 (HMM E-Value=1.4) Length = 1633 Score = 28.7 bits (61), Expect = 2.2 Identities = 18/41 (43%), Positives = 21/41 (51%) Frame = +2 Query: 8 RRSLFTGSEVRNMTRKRRNGGRAKHGRGHVKAVRCTNCARC 130 RR+LFTG E RK RN + KH R K R + A C Sbjct: 683 RRNLFTGEEDLGEGRK-RNTKKDKHSRDKSKFSRRHSVAAC 722 >SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) Length = 2157 Score = 26.6 bits (56), Expect = 8.7 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = +2 Query: 44 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 223 M ++ N K+ R + TNC +K K +NI+ + D D+S+YP Sbjct: 1819 MLYRQNNWYYIKNSRNTEGFIPFTNCIAEDEYEKRQNKLSRQNIIRNTSFLDSMDSSIYP 1878 >SB_10952| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-08) Length = 558 Score = 26.6 bits (56), Expect = 8.7 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 7/46 (15%) Frame = -3 Query: 226 HWVYRGIVN------ISDRRRFYDVPNHELFDGLVLWH-APRAVCA 110 H+ RGI N +S+RR+F V N E D +VL H P+A C+ Sbjct: 441 HYGIRGIANEWFSSYLSNRRQFVSVNNSE-SDEVVLTHGVPQAKCS 485 >SB_43935| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 842 Score = 26.6 bits (56), Expect = 8.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 131 VPKDKAIKKFVIRNIVEAAAVRDINDASVYPMFQLPKL 244 + K K + VI + A AV D++ +VYP+F P L Sbjct: 47 IVKKKRNEGKVIYLFIGALAVTDVSLLAVYPLFAFPVL 84 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,512,184 Number of Sequences: 59808 Number of extensions: 234840 Number of successful extensions: 586 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 826502419 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -