BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h24f (429 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56340.1 68416.m06264 40S ribosomal protein S26 (RPS26C) seve... 161 1e-40 At2g40590.1 68415.m05007 40S ribosomal protein S26 (RPS26B) 158 1e-39 At2g40510.1 68415.m04999 40S ribosomal protein S26 (RPS26A) 158 1e-39 At3g14440.1 68416.m01830 9-cis-epoxycarotenoid dioxygenase, puta... 28 2.3 At1g08910.1 68414.m00991 zinc finger (MIZ type) family protein s... 28 2.3 At3g60200.1 68416.m06726 expressed protein hypothetical proteins... 28 3.1 At1g52450.1 68414.m05921 ubiquitin carboxyl-terminal hydrolase-r... 27 5.4 At5g58440.1 68418.m07319 phox (PX) domain-containing protein sim... 26 9.4 At1g06560.1 68414.m00695 NOL1/NOP2/sun family protein contains P... 26 9.4 >At3g56340.1 68416.m06264 40S ribosomal protein S26 (RPS26C) several 40S ribosomal protein S26 Length = 130 Score = 161 bits (392), Expect = 1e-40 Identities = 72/113 (63%), Positives = 86/113 (76%) Frame = +2 Query: 44 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 223 MT KRRNGGR KH RGHVK +RC+NC +C PKDKAIK+F++RNIVE AA+RD+ +ASVY Sbjct: 1 MTFKRRNGGRNKHNRGHVKPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60 Query: 224 MFQLPKLYAKLHYCVSCAIHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQAVQ 382 + LPKLYAK YCVSCAIHS VVR RS+ +RR+RTPP R P+ Q Sbjct: 61 GYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFARRKEDTPKPAQ 113 >At2g40590.1 68415.m05007 40S ribosomal protein S26 (RPS26B) Length = 131 Score = 158 bits (384), Expect = 1e-39 Identities = 71/113 (62%), Positives = 85/113 (75%) Frame = +2 Query: 44 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 223 MT KRRNGGR KH RGHV +RC+NC +C PKDKAIK+F++RNIVE AA+RD+ +ASVY Sbjct: 1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60 Query: 224 MFQLPKLYAKLHYCVSCAIHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQAVQ 382 + LPKLYAK YCVSCAIHS VVR RS+ +RR+RTPP R P+ Q Sbjct: 61 GYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFTRRKEDTPKPGQ 113 >At2g40510.1 68415.m04999 40S ribosomal protein S26 (RPS26A) Length = 133 Score = 158 bits (384), Expect = 1e-39 Identities = 71/113 (62%), Positives = 85/113 (75%) Frame = +2 Query: 44 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 223 MT KRRNGGR KH RGHV +RC+NC +C PKDKAIK+F++RNIVE AA+RD+ +ASVY Sbjct: 1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60 Query: 224 MFQLPKLYAKLHYCVSCAIHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQAVQ 382 + LPKLYAK YCVSCAIHS VVR RS+ +RR+RTPP R P+ Q Sbjct: 61 GYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFARRKEDTPKPGQ 113 >At3g14440.1 68416.m01830 9-cis-epoxycarotenoid dioxygenase, putative / neoxanthin cleavage enzyme, putative / carotenoid cleavage dioxygenase, putative similar to 9-cis-epoxycarotenoid dioxygenase GB:AAF26356 [GI:6715257][Phaseolus vulgaris] Length = 599 Score = 28.3 bits (60), Expect = 2.3 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +2 Query: 254 LHYCVSCAIHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQAV 379 L YC S + S+V R + + TPP +FP+ S A+ Sbjct: 32 LSYCSSLPMASRVTRKLNVSSA-LHTPPALHFPKQSSNSPAI 72 >At1g08910.1 68414.m00991 zinc finger (MIZ type) family protein similar to putative variable cytadhesin protein (GI:7677312) {Mycoplasma gallisepticum}; contains Pfam PF02891: MIZ zinc finger domain Length = 842 Score = 28.3 bits (60), Expect = 2.3 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = -3 Query: 130 APRAVCASHGFNVTTSMLGASSITALTSHVSNLRSGEQRTAE 5 +P+ + A++ N TSM A S SHV++L + E RT++ Sbjct: 485 SPQDILATNAANFGTSMPAAQSSQFQGSHVTSLGNCEGRTSD 526 >At3g60200.1 68416.m06726 expressed protein hypothetical proteins At2g44600 - Arabidopsis thaliana, EMBL:AAC27462 Length = 305 Score = 27.9 bits (59), Expect = 3.1 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +2 Query: 254 LHYCVSCAIHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQAVQR 385 L S A+ + V N+SKK PP FPR +S P +R Sbjct: 26 LSLAASAAVSAAVEDNQSKKSNNNNHPPLLIFPRSVS-PYVTRR 68 >At1g52450.1 68414.m05921 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1136 Score = 27.1 bits (57), Expect = 5.4 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +2 Query: 101 AVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYPMFQLPKL 244 ++ C C VP+ +K + AVRD+ + ++ P F +P L Sbjct: 572 SILCDRCEEIVPEISLARKIFV------CAVRDVFEGALLPTFDVPDL 613 >At5g58440.1 68418.m07319 phox (PX) domain-containing protein similar to SP|O60749 Sorting nexin 2 {Homo sapiens}; contains Pfam profile PF00787: PX domain Length = 587 Score = 26.2 bits (55), Expect = 9.4 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 Query: 84 DVVTLKP*DAQTARGACQRTRPSKS 158 DVVTL A+T RG C RP KS Sbjct: 204 DVVTLADRLAETYRGFCIPPRPDKS 228 >At1g06560.1 68414.m00695 NOL1/NOP2/sun family protein contains Pfam profile PF01189: NOL1/NOP2/sun family Length = 599 Score = 26.2 bits (55), Expect = 9.4 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = -3 Query: 130 APRAVCASHGFNVTTSMLGASSITALTSHVSNLRSGEQRTA 8 A ++VC N +T ++ + +++TSH S L S E+ T+ Sbjct: 356 ALKSVCLPTTLNESTILINGDNSSSMTSH-SELSSNEEMTS 395 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,631,316 Number of Sequences: 28952 Number of extensions: 157742 Number of successful extensions: 415 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 415 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 675111616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -