BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h23f (659 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 222 2e-58 SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 34 0.12 SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_25421| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 29 2.5 SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 3.4 SB_14427| Best HMM Match : Cadherin (HMM E-Value=0) 29 3.4 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 28 5.9 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_13625| Best HMM Match : Reprolysin (HMM E-Value=2.3e-15) 28 5.9 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 28 7.7 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 222 bits (543), Expect = 2e-58 Identities = 105/185 (56%), Positives = 126/185 (68%) Frame = +2 Query: 104 ARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQT 283 ARP+++V++E E+ LP VFKAPIRPDLVN VH +++KN RQPY V+K AGHQT Sbjct: 2 ARPVITVFNENGESA--GQTTLPAVFKAPIRPDLVNFVHSNIAKNKRQPYAVNKLAGHQT 59 Query: 284 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXXXXXXX 463 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK WR+WH Sbjct: 60 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRKWHTKVNVQQRRF 119 Query: 464 XXXXXXXXXXXXXXXQARGHIIEKIPELPLVVADKVQEINKTKQAVIFLXRLKAWSDILK 643 ARGH IEKI E+PLV++D ++ + KT AV L + A+ D+ K Sbjct: 120 AVCSALAASALPALIMARGHRIEKIAEVPLVISDAIESVTKTSAAVKLLKAVNAYEDVEK 179 Query: 644 VYKSQ 658 S+ Sbjct: 180 CIDSK 184 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 33.9 bits (74), Expect = 0.12 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHWF 279 HH CY H Y Y+ H H + + H YP RH++ Sbjct: 20 HHYCCYCHH---RYCYYRHHHYCWYRHHYHYPCYRHYY 54 >SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 377 YRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHWFGDQ 270 Y +HP T+ YHH H + ++ ++P + H + Q Sbjct: 413 YHQHPQLTHRYHHQ-HPQVIHRYHQHPQVTHRYHQQ 447 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -1 Query: 377 YRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHWFGDQPP 264 Y +HP T+ YH H + H ++P + H + Q P Sbjct: 232 YHQHPQVTHRYHQHPQVTH-RYHQQHPQVTHRYQYQHP 268 >SB_25421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 351 WVPPPRTRGIRATARPVPHD 292 W+PP RTR R T PV H+ Sbjct: 228 WMPPVRTRPARPTVMPVTHE 247 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAEFGQQHVRY 300 HH RH R + +HHH H E+ ++H RY Sbjct: 325 HHQRHRHRHRHR-HRHHHHHHHEYNRRH-RY 353 >SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 401 TYVHHDTCYRRHPDRTYGYHHHGHA 327 TY H DT R+HPD H HA Sbjct: 123 TYTHQDTQMRKHPDTQIYVHAPRHA 147 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 281 TSAESWGTGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 397 T +E +G ++ R PR RGGG G G G RGGR Sbjct: 983 TPSEPSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGRRGGR 1022 >SB_14427| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2325 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +2 Query: 200 DLVNDVHVSMSKNSRQPYCVSKEAGHQTSAESWGTGRAVARI 325 D+ NDV ++++ + PY + H T E TG+ +A++ Sbjct: 2034 DVTNDVTINVTDVNEAPYDIRLVPSHVTVKEDIRTGQCIAQV 2075 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 299 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 427 G GR + R P GGG R G +G M GG P W R Sbjct: 271 GQGRGMGRGP---GGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 310 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 171 GRGLAAPCTVSLFSEYTDTKGRATDRLI 88 G+GL C+V+L S Y T+G+ RL+ Sbjct: 3163 GKGLTTWCSVNLDSVYLSTEGKEVYRLV 3190 >SB_13625| Best HMM Match : Reprolysin (HMM E-Value=2.3e-15) Length = 715 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +2 Query: 194 RPDLVNDVHVSMSKNSRQPYC-VSKEAGHQTSAESWGTGRAV 316 RP +SM K R+PY + +E GH+ S T R V Sbjct: 156 RPGCDTHEKISMEKRKREPYLELIRETGHERQRRSVSTERNV 197 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 27.9 bits (59), Expect = 7.7 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +2 Query: 296 WGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 427 WG G+ + R GGG R G +G M GG P W R Sbjct: 24 WGRGQG-GGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 66 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,082,758 Number of Sequences: 59808 Number of extensions: 451494 Number of successful extensions: 1424 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1381 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -