BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h23f (659 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X13382-1|CAA31759.1| 407|Drosophila melanogaster protein ( Dros... 252 3e-67 BT025959-1|ABG02203.1| 233|Drosophila melanogaster IP15855p pro... 252 3e-67 AY069485-1|AAL39630.1| 401|Drosophila melanogaster LD21756p pro... 252 3e-67 AE014297-4196|AAG22173.1| 401|Drosophila melanogaster CG5502-PA... 252 3e-67 X06881-1|CAA29998.1| 123|Drosophila melanogaster protein ( Dros... 171 7e-43 BT010233-1|AAQ23551.1| 947|Drosophila melanogaster RE59472p pro... 36 0.049 BT003626-1|AAO39629.1| 947|Drosophila melanogaster GH01416p pro... 36 0.049 AY166752-1|AAN85714.1| 1400|Drosophila melanogaster loechrig iso... 36 0.049 AY070541-1|AAL48012.1| 1400|Drosophila melanogaster LD22662p pro... 36 0.049 AE014297-2948|AAF55864.2| 1400|Drosophila melanogaster CG17299-P... 36 0.049 AE014297-2944|AAF55860.2| 947|Drosophila melanogaster CG17299-P... 36 0.049 AE014297-2943|AAN13851.1| 947|Drosophila melanogaster CG17299-P... 36 0.049 D21203-1|BAA04745.2| 1408|Drosophila melanogaster large Forked p... 31 1.8 D17528-1|BAA04479.1| 604|Drosophila melanogaster small forked p... 31 1.8 BT010242-1|AAQ23560.1| 498|Drosophila melanogaster RE48016p pro... 31 1.8 AE013599-2858|AAF57577.1| 537|Drosophila melanogaster CG9811-PA... 31 1.8 AY113210-1|AAM29215.1| 872|Drosophila melanogaster AT06220p pro... 30 2.4 AE014296-2188|AAF49882.2| 271|Drosophila melanogaster CG17666-P... 30 2.4 AE014296-2187|AAN11857.1| 872|Drosophila melanogaster CG17666-P... 30 2.4 BT021357-1|AAX33505.1| 1953|Drosophila melanogaster LP14866p pro... 30 3.2 AE014298-1786|AAF48179.2| 2528|Drosophila melanogaster CG32654-P... 30 3.2 DQ375985-1|ABD37876.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375984-1|ABD37875.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375983-1|ABD37874.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375982-1|ABD37873.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375981-1|ABD37872.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375980-1|ABD37871.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375979-1|ABD37870.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375978-1|ABD37869.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375976-1|ABD37867.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375975-1|ABD37866.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375974-1|ABD37865.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375973-1|ABD37864.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375972-1|ABD37863.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375971-1|ABD37862.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375970-1|ABD37861.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375969-1|ABD37860.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375968-1|ABD37859.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375967-1|ABD37858.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375965-1|ABD37856.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375964-1|ABD37855.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375963-1|ABD37854.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375962-1|ABD37853.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375961-1|ABD37852.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375960-1|ABD37851.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375959-1|ABD37850.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375958-1|ABD37849.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375957-1|ABD37848.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375956-1|ABD37847.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375953-1|ABD37844.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375952-1|ABD37843.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375951-1|ABD37842.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375950-1|ABD37841.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375949-1|ABD37840.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375948-1|ABD37839.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375947-1|ABD37838.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375946-1|ABD37837.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375945-1|ABD37836.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375944-1|ABD37835.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375943-1|ABD37834.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375942-1|ABD37833.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375941-1|ABD37832.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375940-1|ABD37831.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375939-1|ABD37830.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375938-1|ABD37829.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375937-1|ABD37828.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375936-1|ABD37827.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375935-1|ABD37826.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375934-1|ABD37825.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375933-1|ABD37824.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375932-1|ABD37823.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375931-1|ABD37822.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375930-1|ABD37821.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375929-1|ABD37820.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375928-1|ABD37819.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375927-1|ABD37818.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375926-1|ABD37817.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375925-1|ABD37816.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375924-1|ABD37815.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375922-1|ABD37813.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375921-1|ABD37812.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375920-1|ABD37811.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375919-1|ABD37810.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375918-1|ABD37809.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375917-1|ABD37808.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375916-1|ABD37807.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375915-1|ABD37806.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375914-1|ABD37805.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375913-1|ABD37804.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375911-1|ABD37802.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375910-1|ABD37801.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375909-1|ABD37800.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375908-1|ABD37799.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375907-1|ABD37798.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375906-1|ABD37797.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375904-1|ABD37795.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375903-1|ABD37794.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375902-1|ABD37793.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375901-1|ABD37792.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375900-1|ABD37791.1| 430|Drosophila melanogaster catsup prote... 29 4.2 DQ375899-1|ABD37790.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375898-1|ABD37789.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375897-1|ABD37788.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375896-1|ABD37787.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375895-1|ABD37786.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375894-1|ABD37785.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375893-1|ABD37784.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375892-1|ABD37783.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375891-1|ABD37782.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375890-1|ABD37781.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375889-1|ABD37780.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375888-1|ABD37779.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375887-1|ABD37778.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375886-1|ABD37777.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375885-1|ABD37776.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375884-1|ABD37775.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375883-1|ABD37774.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375882-1|ABD37773.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375881-1|ABD37772.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375880-1|ABD37771.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375879-1|ABD37770.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375878-1|ABD37769.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375877-1|ABD37768.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375876-1|ABD37767.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375875-1|ABD37766.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375874-1|ABD37765.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375873-1|ABD37764.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375872-1|ABD37763.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375871-1|ABD37762.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375870-1|ABD37761.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375869-1|ABD37760.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375868-1|ABD37759.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375867-1|ABD37758.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375866-1|ABD37757.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375865-1|ABD37756.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375864-1|ABD37755.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375863-1|ABD37754.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375862-1|ABD37753.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375861-1|ABD37752.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375860-1|ABD37751.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375859-1|ABD37750.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375858-1|ABD37749.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375856-1|ABD37747.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375855-1|ABD37746.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375854-1|ABD37745.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375853-1|ABD37744.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375852-1|ABD37743.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375851-1|ABD37742.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375850-1|ABD37741.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375849-1|ABD37740.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375848-1|ABD37739.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375847-1|ABD37738.1| 430|Drosophila melanogaster catsup prote... 29 4.2 DQ375846-1|ABD37737.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375845-1|ABD37736.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375844-1|ABD37735.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375843-1|ABD37734.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375842-1|ABD37733.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375841-1|ABD37732.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375840-1|ABD37731.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375838-1|ABD37729.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375837-1|ABD37728.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375836-1|ABD37727.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375835-1|ABD37726.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375833-1|ABD37724.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375832-1|ABD37723.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375831-1|ABD37722.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375830-1|ABD37721.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375829-1|ABD37720.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375828-1|ABD37719.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375827-1|ABD37718.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375826-1|ABD37717.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375825-1|ABD37716.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375824-1|ABD37715.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375823-1|ABD37714.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375822-1|ABD37713.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375821-1|ABD37712.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375820-1|ABD37711.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375819-1|ABD37710.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375818-1|ABD37709.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375817-1|ABD37708.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375816-1|ABD37707.1| 449|Drosophila melanogaster catsup prote... 29 4.2 DQ375815-1|ABD37706.1| 449|Drosophila melanogaster catsup prote... 29 4.2 AY058528-1|AAL13757.1| 449|Drosophila melanogaster LD23513p pro... 29 4.2 AF216584-1|AAF37226.1| 449|Drosophila melanogaster seven transm... 29 4.2 AE014134-3021|AAF53744.1| 449|Drosophila melanogaster CG10449-P... 29 4.2 AY071142-1|AAL48764.1| 572|Drosophila melanogaster RE17942p pro... 29 5.6 AF223064-1|AAF34687.1| 571|Drosophila melanogaster putative mic... 29 5.6 AE014297-195|AAF52059.2| 572|Drosophila melanogaster CG10229-PA... 29 5.6 BT003320-1|AAO25080.1| 798|Drosophila melanogaster AT11823p pro... 28 9.8 AY069327-1|AAL39472.2| 552|Drosophila melanogaster LD04591p pro... 28 9.8 AE014297-4076|AAF56673.2| 980|Drosophila melanogaster CG6051-PA... 28 9.8 >X13382-1|CAA31759.1| 407|Drosophila melanogaster protein ( Drosophila melanogastermRNA for put. ribosomal protein L1. ). Length = 407 Score = 252 bits (617), Expect = 3e-67 Identities = 121/190 (63%), Positives = 141/190 (74%) Frame = +2 Query: 89 MSLSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKE 268 MSL ARPLVSVY+EK+E + LP VFKAPIRPD+VN+VH + +N+RQ Y VS+ Sbjct: 1 MSLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSEL 60 Query: 269 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXX 448 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK +RRWH Sbjct: 61 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFRRWHRKVNV 120 Query: 449 XXXXXXXXXXXXXXXXXXXXQARGHIIEKIPELPLVVADKVQEINKTKQAVIFLXRLKAW 628 Q++GH+I+ + E PLVV+D+VQ++ KTKQAVIFL RLK W Sbjct: 121 NQRRYALVSAIAASGVPALVQSKGHVIDGVSEFPLVVSDEVQKVQKTKQAVIFLRRLKIW 180 Query: 629 SDILKVYKSQ 658 +DI KVYKSQ Sbjct: 181 ADIQKVYKSQ 190 >BT025959-1|ABG02203.1| 233|Drosophila melanogaster IP15855p protein. Length = 233 Score = 252 bits (617), Expect = 3e-67 Identities = 121/190 (63%), Positives = 141/190 (74%) Frame = +2 Query: 89 MSLSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKE 268 MSL ARPLVSVY+EK+E + LP VFKAPIRPD+VN+VH + +N+RQ Y VS+ Sbjct: 1 MSLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSEL 60 Query: 269 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXX 448 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK +RRWH Sbjct: 61 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFRRWHRKVNV 120 Query: 449 XXXXXXXXXXXXXXXXXXXXQARGHIIEKIPELPLVVADKVQEINKTKQAVIFLXRLKAW 628 Q++GH+I+ + E PLVV+D+VQ++ KTKQAVIFL RLK W Sbjct: 121 NQRRYALVSAIAASGVPALVQSKGHVIDGVSEFPLVVSDEVQKVQKTKQAVIFLRRLKIW 180 Query: 629 SDILKVYKSQ 658 +DI KVYKSQ Sbjct: 181 ADIQKVYKSQ 190 >AY069485-1|AAL39630.1| 401|Drosophila melanogaster LD21756p protein. Length = 401 Score = 252 bits (617), Expect = 3e-67 Identities = 121/190 (63%), Positives = 141/190 (74%) Frame = +2 Query: 89 MSLSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKE 268 MSL ARPLVSVY+EK+E + LP VFKAPIRPD+VN+VH + +N+RQ Y VS+ Sbjct: 1 MSLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSEL 60 Query: 269 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXX 448 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK +RRWH Sbjct: 61 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFRRWHRKVNV 120 Query: 449 XXXXXXXXXXXXXXXXXXXXQARGHIIEKIPELPLVVADKVQEINKTKQAVIFLXRLKAW 628 Q++GH+I+ + E PLVV+D+VQ++ KTKQAVIFL RLK W Sbjct: 121 NQRRYALVSAIAASGVPALVQSKGHVIDGVSEFPLVVSDEVQKVQKTKQAVIFLRRLKIW 180 Query: 629 SDILKVYKSQ 658 +DI KVYKSQ Sbjct: 181 ADIQKVYKSQ 190 >AE014297-4196|AAG22173.1| 401|Drosophila melanogaster CG5502-PA protein. Length = 401 Score = 252 bits (617), Expect = 3e-67 Identities = 121/190 (63%), Positives = 141/190 (74%) Frame = +2 Query: 89 MSLSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKE 268 MSL ARPLVSVY+EK+E + LP VFKAPIRPD+VN+VH + +N+RQ Y VS+ Sbjct: 1 MSLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSEL 60 Query: 269 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXX 448 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK +RRWH Sbjct: 61 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFRRWHRKVNV 120 Query: 449 XXXXXXXXXXXXXXXXXXXXQARGHIIEKIPELPLVVADKVQEINKTKQAVIFLXRLKAW 628 Q++GH+I+ + E PLVV+D+VQ++ KTKQAVIFL RLK W Sbjct: 121 NQRRYALVSAIAASGVPALVQSKGHVIDGVSEFPLVVSDEVQKVQKTKQAVIFLRRLKIW 180 Query: 629 SDILKVYKSQ 658 +DI KVYKSQ Sbjct: 181 ADIQKVYKSQ 190 >X06881-1|CAA29998.1| 123|Drosophila melanogaster protein ( Drosophila gene forribosomal protein L1 fragment. ). Length = 123 Score = 171 bits (416), Expect = 7e-43 Identities = 79/123 (64%), Positives = 90/123 (73%) Frame = +2 Query: 275 HQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXXXX 454 HQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK +RRWH Sbjct: 1 HQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFRRWHRRVNVNQ 60 Query: 455 XXXXXXXXXXXXXXXXXXQARGHIIEKIPELPLVVADKVQEINKTKQAVIFLXRLKAWSD 634 Q++GH+I+ + E PLVV+D+VQ++ KTKQAVIFL RLK W+D Sbjct: 61 RRYALVSAIAASGVPALVQSKGHVIDGVSEFPLVVSDEVQKVQKTKQAVIFLRRLKIWAD 120 Query: 635 ILK 643 I K Sbjct: 121 IQK 123 >BT010233-1|AAQ23551.1| 947|Drosophila melanogaster RE59472p protein. Length = 947 Score = 35.9 bits (79), Expect = 0.049 Identities = 29/88 (32%), Positives = 35/88 (39%), Gaps = 2/88 (2%) Frame = +2 Query: 143 TVQGAAKP--LPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQTSAESWGTGRAV 316 TV G A P P +F RP +D K+ P A T + S GTG A Sbjct: 217 TVHGIASPNRRPTIFDV-FRPRAKSDAKRQKEKHLLDPSSADSSATSSTYSVSGGTGPAT 275 Query: 317 ARIPRVRGGGTHRSGQGAFGNMCRGGRM 400 + GG +GQGA G GG M Sbjct: 276 SSAAGGAGGAAAAAGQGAAGG--AGGLM 301 >BT003626-1|AAO39629.1| 947|Drosophila melanogaster GH01416p protein. Length = 947 Score = 35.9 bits (79), Expect = 0.049 Identities = 29/88 (32%), Positives = 35/88 (39%), Gaps = 2/88 (2%) Frame = +2 Query: 143 TVQGAAKP--LPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQTSAESWGTGRAV 316 TV G A P P +F RP +D K+ P A T + S GTG A Sbjct: 217 TVHGIASPNRRPTIFDV-FRPRAKSDAKRQKEKHLLDPSSADSSATSSTYSVSGGTGPAT 275 Query: 317 ARIPRVRGGGTHRSGQGAFGNMCRGGRM 400 + GG +GQGA G GG M Sbjct: 276 SSAAGGAGGAAAAAGQGAAGG--AGGLM 301 >AY166752-1|AAN85714.1| 1400|Drosophila melanogaster loechrig isoform I protein. Length = 1400 Score = 35.9 bits (79), Expect = 0.049 Identities = 29/88 (32%), Positives = 35/88 (39%), Gaps = 2/88 (2%) Frame = +2 Query: 143 TVQGAAKP--LPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQTSAESWGTGRAV 316 TV G A P P +F RP +D K+ P A T + S GTG A Sbjct: 670 TVHGIASPNRRPTIFDV-FRPRAKSDAKRQKEKHLLDPSSADSSATSSTYSVSGGTGPAT 728 Query: 317 ARIPRVRGGGTHRSGQGAFGNMCRGGRM 400 + GG +GQGA G GG M Sbjct: 729 SSAAGGAGGAAAAAGQGAAGG--AGGLM 754 >AY070541-1|AAL48012.1| 1400|Drosophila melanogaster LD22662p protein. Length = 1400 Score = 35.9 bits (79), Expect = 0.049 Identities = 29/88 (32%), Positives = 35/88 (39%), Gaps = 2/88 (2%) Frame = +2 Query: 143 TVQGAAKP--LPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQTSAESWGTGRAV 316 TV G A P P +F RP +D K+ P A T + S GTG A Sbjct: 670 TVHGIASPNRRPTIFDV-FRPRAKSDAKRQKEKHLLDPSSADSSATSSTYSVSGGTGPAT 728 Query: 317 ARIPRVRGGGTHRSGQGAFGNMCRGGRM 400 + GG +GQGA G GG M Sbjct: 729 SSAAGGAGGAAAAAGQGAAGG--AGGLM 754 >AE014297-2948|AAF55864.2| 1400|Drosophila melanogaster CG17299-PF, isoform F protein. Length = 1400 Score = 35.9 bits (79), Expect = 0.049 Identities = 29/88 (32%), Positives = 35/88 (39%), Gaps = 2/88 (2%) Frame = +2 Query: 143 TVQGAAKP--LPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQTSAESWGTGRAV 316 TV G A P P +F RP +D K+ P A T + S GTG A Sbjct: 670 TVHGIASPNRRPTIFDV-FRPRAKSDAKRQKEKHLLDPSSADSSATSSTYSVSGGTGPAT 728 Query: 317 ARIPRVRGGGTHRSGQGAFGNMCRGGRM 400 + GG +GQGA G GG M Sbjct: 729 SSAAGGAGGAAAAAGQGAAGG--AGGLM 754 >AE014297-2944|AAF55860.2| 947|Drosophila melanogaster CG17299-PB, isoform B protein. Length = 947 Score = 35.9 bits (79), Expect = 0.049 Identities = 29/88 (32%), Positives = 35/88 (39%), Gaps = 2/88 (2%) Frame = +2 Query: 143 TVQGAAKP--LPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQTSAESWGTGRAV 316 TV G A P P +F RP +D K+ P A T + S GTG A Sbjct: 217 TVHGIASPNRRPTIFDV-FRPRAKSDAKRQKEKHLLDPSSADSSATSSTYSVSGGTGPAT 275 Query: 317 ARIPRVRGGGTHRSGQGAFGNMCRGGRM 400 + GG +GQGA G GG M Sbjct: 276 SSAAGGAGGAAAAAGQGAAGG--AGGLM 301 >AE014297-2943|AAN13851.1| 947|Drosophila melanogaster CG17299-PA, isoform A protein. Length = 947 Score = 35.9 bits (79), Expect = 0.049 Identities = 29/88 (32%), Positives = 35/88 (39%), Gaps = 2/88 (2%) Frame = +2 Query: 143 TVQGAAKP--LPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQTSAESWGTGRAV 316 TV G A P P +F RP +D K+ P A T + S GTG A Sbjct: 217 TVHGIASPNRRPTIFDV-FRPRAKSDAKRQKEKHLLDPSSADSSATSSTYSVSGGTGPAT 275 Query: 317 ARIPRVRGGGTHRSGQGAFGNMCRGGRM 400 + GG +GQGA G GG M Sbjct: 276 SSAAGGAGGAAAAAGQGAAGG--AGGLM 301 >D21203-1|BAA04745.2| 1408|Drosophila melanogaster large Forked protein protein. Length = 1408 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = -1 Query: 395 VHHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHWFGDQPP 264 + TC R P + H H H H +P H G+QPP Sbjct: 1010 IRRTTCRYRSPSSRHP-HQHQHHPHPHPHPHHPHQLHGMGEQPP 1052 >D17528-1|BAA04479.1| 604|Drosophila melanogaster small forked protein protein. Length = 604 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = -1 Query: 395 VHHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHWFGDQPP 264 + TC R P + H H H H +P H G+QPP Sbjct: 209 IRRTTCRYRSPSSRHP-HQHQHHPHPHPHPHHPHQLHGMGEQPP 251 >BT010242-1|AAQ23560.1| 498|Drosophila melanogaster RE48016p protein. Length = 498 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = -2 Query: 604 DDSLFGLVDLLDFVGYNQGKLGNLFNNVSSSLNERWDASSSN-GCCQGRSPLSEVDATVP 428 D+ L GL+ + N K +LF S ++R S N GC +PL + V Sbjct: 392 DELLVGLLSQIRLKLENPEKSRDLFRKRSIRKSKRRACSPLNAGCLNANTPLGPLGEAVA 451 Query: 427 APPG 416 PPG Sbjct: 452 TPPG 455 >AE013599-2858|AAF57577.1| 537|Drosophila melanogaster CG9811-PA protein. Length = 537 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = -2 Query: 604 DDSLFGLVDLLDFVGYNQGKLGNLFNNVSSSLNERWDASSSN-GCCQGRSPLSEVDATVP 428 D+ L GL+ + N K +LF S ++R S N GC +PL + V Sbjct: 431 DELLVGLLSQIRLKLENPEKSRDLFRKRSIRKSKRRACSPLNAGCLNANTPLGPLGEAVA 490 Query: 427 APPG 416 PPG Sbjct: 491 TPPG 494 >AY113210-1|AAM29215.1| 872|Drosophila melanogaster AT06220p protein. Length = 872 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +1 Query: 307 TCCCP-NSACPWWWYP*VRSGC 369 TCC P ++ CPW WY +GC Sbjct: 718 TCCMPCSNQCPWSWYYNPCTGC 739 >AE014296-2188|AAF49882.2| 271|Drosophila melanogaster CG17666-PB, isoform B protein. Length = 271 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +1 Query: 307 TCCCP-NSACPWWWYP*VRSGC 369 TCC P ++ CPW WY +GC Sbjct: 117 TCCMPCSNQCPWSWYYNPCTGC 138 >AE014296-2187|AAN11857.1| 872|Drosophila melanogaster CG17666-PA, isoform A protein. Length = 872 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +1 Query: 307 TCCCP-NSACPWWWYP*VRSGC 369 TCC P ++ CPW WY +GC Sbjct: 718 TCCMPCSNQCPWSWYYNPCTGC 739 >BT021357-1|AAX33505.1| 1953|Drosophila melanogaster LP14866p protein. Length = 1953 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +1 Query: 94 SIGSPTFSVGVFREE*DGAGCSQAPPVRIQG--AHTSGPG 207 ++GSP ++VG G G S APP + AH +G G Sbjct: 287 AVGSPIYAVGASSAHSAGVGASPAPPTGVVAPPAHLAGIG 326 >AE014298-1786|AAF48179.2| 2528|Drosophila melanogaster CG32654-PC protein. Length = 2528 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +1 Query: 94 SIGSPTFSVGVFREE*DGAGCSQAPPVRIQG--AHTSGPG 207 ++GSP ++VG G G S APP + AH +G G Sbjct: 287 AVGSPIYAVGASSAHSAGVGASPAPPTGVVAPPAHLAGIG 326 >DQ375985-1|ABD37876.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375984-1|ABD37875.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375983-1|ABD37874.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375982-1|ABD37873.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375981-1|ABD37872.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375980-1|ABD37871.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375979-1|ABD37870.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375978-1|ABD37869.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375976-1|ABD37867.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375975-1|ABD37866.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375974-1|ABD37865.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375973-1|ABD37864.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375972-1|ABD37863.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375971-1|ABD37862.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375970-1|ABD37861.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375969-1|ABD37860.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375968-1|ABD37859.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375967-1|ABD37858.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375965-1|ABD37856.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375964-1|ABD37855.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375963-1|ABD37854.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375962-1|ABD37853.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375961-1|ABD37852.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375960-1|ABD37851.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375959-1|ABD37850.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375958-1|ABD37849.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375957-1|ABD37848.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375956-1|ABD37847.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375953-1|ABD37844.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375952-1|ABD37843.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375951-1|ABD37842.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375950-1|ABD37841.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375949-1|ABD37840.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375948-1|ABD37839.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375947-1|ABD37838.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375946-1|ABD37837.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375945-1|ABD37836.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375944-1|ABD37835.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375943-1|ABD37834.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375942-1|ABD37833.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375941-1|ABD37832.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375940-1|ABD37831.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375939-1|ABD37830.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375938-1|ABD37829.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375937-1|ABD37828.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375936-1|ABD37827.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375935-1|ABD37826.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375934-1|ABD37825.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375933-1|ABD37824.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375932-1|ABD37823.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375931-1|ABD37822.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375930-1|ABD37821.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375929-1|ABD37820.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375928-1|ABD37819.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375927-1|ABD37818.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375926-1|ABD37817.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375925-1|ABD37816.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375924-1|ABD37815.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375922-1|ABD37813.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375921-1|ABD37812.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375920-1|ABD37811.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375919-1|ABD37810.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375918-1|ABD37809.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375917-1|ABD37808.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375916-1|ABD37807.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375915-1|ABD37806.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375914-1|ABD37805.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375913-1|ABD37804.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375911-1|ABD37802.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375910-1|ABD37801.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375909-1|ABD37800.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375908-1|ABD37799.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375907-1|ABD37798.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375906-1|ABD37797.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375904-1|ABD37795.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375903-1|ABD37794.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375902-1|ABD37793.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375901-1|ABD37792.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375900-1|ABD37791.1| 430|Drosophila melanogaster catsup protein protein. Length = 430 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 76 HHHHGHDHDHDHDHGHHHHGHDE 98 >DQ375899-1|ABD37790.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375898-1|ABD37789.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375897-1|ABD37788.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375896-1|ABD37787.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375895-1|ABD37786.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375894-1|ABD37785.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375893-1|ABD37784.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375892-1|ABD37783.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375891-1|ABD37782.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375890-1|ABD37781.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375889-1|ABD37780.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375888-1|ABD37779.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375887-1|ABD37778.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375886-1|ABD37777.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375885-1|ABD37776.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375884-1|ABD37775.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375883-1|ABD37774.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375882-1|ABD37773.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375881-1|ABD37772.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375880-1|ABD37771.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375879-1|ABD37770.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375878-1|ABD37769.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375877-1|ABD37768.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375876-1|ABD37767.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375875-1|ABD37766.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375874-1|ABD37765.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375873-1|ABD37764.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375872-1|ABD37763.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375871-1|ABD37762.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375870-1|ABD37761.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375869-1|ABD37760.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375868-1|ABD37759.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375867-1|ABD37758.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375866-1|ABD37757.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375865-1|ABD37756.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375864-1|ABD37755.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375863-1|ABD37754.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375862-1|ABD37753.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375861-1|ABD37752.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375860-1|ABD37751.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375859-1|ABD37750.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375858-1|ABD37749.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375856-1|ABD37747.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375855-1|ABD37746.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375854-1|ABD37745.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375853-1|ABD37744.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375852-1|ABD37743.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375851-1|ABD37742.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375850-1|ABD37741.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375849-1|ABD37740.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375848-1|ABD37739.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375847-1|ABD37738.1| 430|Drosophila melanogaster catsup protein protein. Length = 430 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 76 HHHHGHDHDHDHDHGHHHHGHDE 98 >DQ375846-1|ABD37737.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375845-1|ABD37736.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375844-1|ABD37735.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375843-1|ABD37734.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375842-1|ABD37733.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375841-1|ABD37732.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375840-1|ABD37731.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375838-1|ABD37729.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375837-1|ABD37728.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375836-1|ABD37727.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375835-1|ABD37726.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375833-1|ABD37724.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375832-1|ABD37723.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375831-1|ABD37722.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375830-1|ABD37721.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375829-1|ABD37720.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375828-1|ABD37719.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375827-1|ABD37718.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375826-1|ABD37717.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375825-1|ABD37716.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375824-1|ABD37715.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375823-1|ABD37714.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375822-1|ABD37713.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375821-1|ABD37712.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375820-1|ABD37711.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375819-1|ABD37710.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375818-1|ABD37709.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375817-1|ABD37708.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375816-1|ABD37707.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375815-1|ABD37706.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >AY058528-1|AAL13757.1| 449|Drosophila melanogaster LD23513p protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >AF216584-1|AAF37226.1| 449|Drosophila melanogaster seven transmembrane protein Catecholaminesup protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >AE014134-3021|AAF53744.1| 449|Drosophila melanogaster CG10449-PA protein. Length = 449 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAE 324 HH + D +G+HHHGH E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >AY071142-1|AAL48764.1| 572|Drosophila melanogaster RE17942p protein. Length = 572 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 366 P*PDLWVPPPRTRGIRATARPVPHDSAL 283 P PD+W PPP+ + +P P A+ Sbjct: 133 PDPDIWTPPPKDPDVWGPPKPPPTTQAV 160 >AF223064-1|AAF34687.1| 571|Drosophila melanogaster putative microtubule severingprotein katanin p60 subunit protein. Length = 571 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 366 P*PDLWVPPPRTRGIRATARPVPHDSAL 283 P PD+W PPP+ + +P P A+ Sbjct: 133 PDPDIWTPPPKDPDVWGPPKPPPTTQAV 160 >AE014297-195|AAF52059.2| 572|Drosophila melanogaster CG10229-PA protein. Length = 572 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 366 P*PDLWVPPPRTRGIRATARPVPHDSAL 283 P PD+W PPP+ + +P P A+ Sbjct: 133 PDPDIWTPPPKDPDVWGPPKPPPTTQAV 160 >BT003320-1|AAO25080.1| 798|Drosophila melanogaster AT11823p protein. Length = 798 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYP 297 H D+ RH R + +HHH H Q +P Sbjct: 384 HRDSHSHRHHQRHHHHHHHRHPHQHQHRQPHP 415 >AY069327-1|AAL39472.2| 552|Drosophila melanogaster LD04591p protein. Length = 552 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYP 297 H D+ RH R + +HHH H Q +P Sbjct: 138 HRDSHSHRHHQRHHHHHHHRHPHQHQHRQPHP 169 >AE014297-4076|AAF56673.2| 980|Drosophila melanogaster CG6051-PA protein. Length = 980 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 392 HHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYP 297 H D+ RH R + +HHH H Q +P Sbjct: 566 HRDSHSHRHHQRHHHHHHHRHPHQHQHRQPHP 597 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,314,775 Number of Sequences: 53049 Number of extensions: 705664 Number of successful extensions: 3838 Number of sequences better than 10.0: 191 Number of HSP's better than 10.0 without gapping: 3023 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3795 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2827453950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -