BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h22r (751 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC27B12.04c |||conserved eukaryotic protein|Schizosaccharomyce... 26 6.6 SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizo... 25 8.7 >SPBC27B12.04c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 817 Score = 25.8 bits (54), Expect = 6.6 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 695 QHTFISRNKFETFLNYLSSFHKQICTINVTNK 600 +H+F+ ++ E FLN L S T+N T+K Sbjct: 164 KHSFLDNSRDEGFLNLLLSLMFFFLTLNNTDK 195 >SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1826 Score = 25.4 bits (53), Expect = 8.7 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 193 TYLHFIHNLFKRP*NVKLHIYWNF 264 T+LHF+HN F R + + ++W F Sbjct: 416 TWLHFLHN-FSRIWILHISVFWYF 438 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,718,745 Number of Sequences: 5004 Number of extensions: 50957 Number of successful extensions: 74 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -