BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h21r (507 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC821.05 |||translation initiation factor eIF3h|Schizosaccharo... 30 0.17 SPAC22G7.07c |||mRNA |Schizosaccharomyces pombe|chr 1|||Manual 27 2.1 SPBC27B12.03c |||lathosterol oxidase |Schizosaccharomyces pombe|... 26 3.7 SPBC1A4.05 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 25 4.9 SPAC1B3.15c |||membrane transporter|Schizosaccharomyces pombe|ch... 25 6.5 SPAC1B3.16c |vht1||vitamin H transporter Vth1|Schizosaccharomyce... 25 6.5 SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 25 8.6 >SPAC821.05 |||translation initiation factor eIF3h|Schizosaccharomyces pombe|chr 1|||Manual Length = 357 Score = 30.3 bits (65), Expect = 0.17 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = -3 Query: 328 YVYQPARPNTIQY-QDIVYRGNATTRITAIQAT-EVGATQYASAWILSGGLSQNNVT 164 Y YQ A PN+I + D+ N T + A Q T E A W S L+ +N+T Sbjct: 127 YAYQKANPNSIAFLYDLSQSSNGTLYMRAYQLTPEFMAAHEEKTWTAS-SLNSHNLT 182 >SPAC22G7.07c |||mRNA |Schizosaccharomyces pombe|chr 1|||Manual Length = 413 Score = 26.6 bits (56), Expect = 2.1 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 298 IQYQDIVYRGNATTRITAIQATEVGATQYAS 206 +Q+QDIVYR N + QA Q+ S Sbjct: 81 VQFQDIVYRSNTSASEIHFQAENAPLVQWYS 111 >SPBC27B12.03c |||lathosterol oxidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 329 Score = 25.8 bits (54), Expect = 3.7 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 250 TAIQATEVGATQYASAWILSGGLSQNNVTVRFQS 149 TA+ +T +G + + I SG L +NNV +F S Sbjct: 33 TAVNSTTLGLAEKVNFAITSGLLDRNNVWRQFTS 66 >SPBC1A4.05 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 700 Score = 25.4 bits (53), Expect = 4.9 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -1 Query: 270 VTQRRALRLYRPRKLGQLSTHQPGSCLAGSVRTTSRSDSNQL 145 V Q R + L R L + ++ PGSCL G+ T+ + QL Sbjct: 402 VAQLRDIVL-RSETLAENPSNMPGSCLPGASSNTADEFTEQL 442 >SPAC1B3.15c |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 628 Score = 25.0 bits (52), Expect = 6.5 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -3 Query: 139 YGYYYLFDVWGR*FFDNSSFIKLSKYCT*HSYLQETILS 23 YGY ++F +WG F F+ C H+ E +S Sbjct: 325 YGYQWMFLIWGVVAFTQGLFLPRWLPCIKHNQHNEKWIS 363 >SPAC1B3.16c |vht1||vitamin H transporter Vth1|Schizosaccharomyces pombe|chr 1|||Manual Length = 568 Score = 25.0 bits (52), Expect = 6.5 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -3 Query: 214 YASAWILSGGLSQNNVTV-RFQSARG-YGYYYLFDVWG 107 Y +A I + +S + + ARG YGY ++F +WG Sbjct: 226 YTAAQIAAAAVSLVSAGFQKMDGARGLYGYQWMFLIWG 263 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 24.6 bits (51), Expect = 8.6 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 330 DLYKSLSPVLT*PTIRLALVLDGSMAA 410 D Y LS +LT + RLAL D ++ A Sbjct: 255 DDYNELSSILTTTSARLALTTDANLKA 281 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,057,701 Number of Sequences: 5004 Number of extensions: 39546 Number of successful extensions: 81 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -