BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h21f (563 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35832| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_13470| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 >SB_35832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 444 Score = 28.7 bits (61), Expect = 3.5 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = +3 Query: 78 VVLAATNAAILPSSTRANLIVGYVSTGDRLLYRS 179 V++ TN AI P STR L G + T D LYRS Sbjct: 324 VLIRFTNRAI-PRSTRIRLCGGVIVTHDGKLYRS 356 >SB_13470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1483 Score = 27.5 bits (58), Expect = 8.0 Identities = 8/21 (38%), Positives = 18/21 (85%) Frame = +2 Query: 248 DAHYGYTGHGSWGNSVRISLD 310 +++YG+ G S+GN++++S+D Sbjct: 1418 ESYYGWDGVCSYGNAIKVSID 1438 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,375,766 Number of Sequences: 59808 Number of extensions: 317114 Number of successful extensions: 689 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 688 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -