BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h21f (563 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 23 2.8 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 2.8 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 22.6 bits (46), Expect = 2.8 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = +3 Query: 264 IQATEVGATQYASAWILSGGLSQNN 338 + A ++ ++ W+L GL NN Sbjct: 128 VSAFKIAVDKFDRLWVLDSGLVNNN 152 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.6 bits (46), Expect = 2.8 Identities = 27/90 (30%), Positives = 38/90 (42%), Gaps = 5/90 (5%) Frame = +1 Query: 175 DPTYTSQLGR----ILFNTKT*CIAVTQRRALRLYRPRKLGQLSTHQPGSCLAGSV-RTT 339 D TY +L R +FN CI + L Y P + G+ T + L+ +V T Sbjct: 202 DITYEIRLRRRPMFYVFNLILPCILINSVALLVFYVPSESGEKVTLGISALLSMTVFLMT 261 Query: 340 SRSDSNQLEDTDIITSSTYGDANFLITLLS 429 R E T +I S YG + L+T S Sbjct: 262 IRESLPPTEKTPLI-SLYYGVSICLVTFAS 290 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,848 Number of Sequences: 438 Number of extensions: 3024 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16317903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -