BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h19r (731 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g05690.1 68414.m00590 TAZ zinc finger family protein / BTB/PO... 29 4.2 At5g53780.1 68418.m06683 hypothetical protein contains Pfam prof... 28 5.6 >At1g05690.1 68414.m00590 TAZ zinc finger family protein / BTB/POZ domain-containing protein contains Pfam PF00651 : BTB/POZ domain; contains Pfam PF02135 : TAZ zinc finger; similar to p300/CBP acetyltransferase-related protein (GI:12597461) [Arabidopsis thaliana]; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 364 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 678 RKSCSHCSHLYVFFQLHS 731 R SCSHC ++ QLHS Sbjct: 290 RASCSHCKRMWQLLQLHS 307 >At5g53780.1 68418.m06683 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 376 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 556 CLMKYNK*RKHADLHISKL-FLALANWELIIMCTKLQ 449 C N +K+ LH+ + + + WEL+ MC K++ Sbjct: 218 CSFDLNMNKKYTRLHLRNIPMMPQSEWELLAMCIKIE 254 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,493,863 Number of Sequences: 28952 Number of extensions: 352616 Number of successful extensions: 830 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 830 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -