BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h14r (724 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49960.1 68418.m06186 expressed protein ; expression supporte... 32 0.33 At4g05260.1 68417.m00795 ubiquitin family protein contains INTER... 29 2.4 At2g28870.1 68415.m03509 expressed protein 29 4.1 At1g53840.1 68414.m06128 pectinesterase family protein contains ... 29 4.1 At5g52400.1 68418.m06501 cytochrome P450 family protein similar ... 28 5.5 At3g22170.1 68416.m02798 far-red impaired responsive protein, pu... 27 9.5 At1g52040.1 68414.m05871 jacalin lectin family protein nearly id... 27 9.5 >At5g49960.1 68418.m06186 expressed protein ; expression supported by MPSS Length = 824 Score = 32.3 bits (70), Expect = 0.33 Identities = 18/73 (24%), Positives = 34/73 (46%), Gaps = 1/73 (1%) Frame = -2 Query: 255 CLDDACSHSYAYVFYAESIRQAVDGGNEFVGTACNSYEEARNLRCSGPRDAIFGGIEVKE 76 CL CS S+ YV + S ++ N + T CNS + + + R +F + + Sbjct: 86 CLKFICSCSFTYVMFLRSKVSRLEAENIILLTRCNSSSDNNEMEETNSRAVVFFSVIITF 145 Query: 75 V-EMGIYIFLTNI 40 V +Y++L ++ Sbjct: 146 VLPFLLYMYLDDL 158 >At4g05260.1 68417.m00795 ubiquitin family protein contains INTERPRO:IPR000626 ubiquitin domain Length = 259 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 619 PVDGDYVYIFSGEVSGYDESVEVSSDXFTVIV 714 P DGDY ++ G V D+S E +S T IV Sbjct: 219 PQDGDYFFVHKGRVLNEDQSFEWNSVAHTDIV 250 >At2g28870.1 68415.m03509 expressed protein Length = 156 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 446 EFLAAIPAMCPPRPSPTMRISSES*LKV 529 + L+A+P +CPP P R+ S S LKV Sbjct: 93 QILSAMPRICPPAPRKPKRVPSRS-LKV 119 >At1g53840.1 68414.m06128 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 586 Score = 28.7 bits (61), Expect = 4.1 Identities = 23/79 (29%), Positives = 35/79 (44%) Frame = -3 Query: 317 VMTILWEISTFIPPAVAVKADAWTMPAPILTPMFSTPNLSGKQ*MEVMSSSELLAIATKK 138 V+ ++ I + V K + P+P P TP+ S K V E + K Sbjct: 36 VVVLIAVIIAAVVATVVHKNKNESTPSP---PPELTPSTSLKAICSVTRFPESCISSISK 92 Query: 137 LATSDALDPETPFSVELKL 81 L +S+ DPET F + LK+ Sbjct: 93 LPSSNTTDPETLFKLSLKV 111 >At5g52400.1 68418.m06501 cytochrome P450 family protein similar to Cytochrome P450 72A1 (SP:Q05047) (cytochrome P450 lxxii hydroxylase) (ge10h) [Catharanthus roseus] Length = 519 Score = 28.3 bits (60), Expect = 5.5 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -3 Query: 272 VAVKADAWTMPAPILTPMFSTPNLSGKQ*MEVMSSSELL 156 V V+ D WT I+TP F+ NL M V S S +L Sbjct: 154 VMVEGDDWTRHRHIITPAFAPLNLKVMTNMMVESVSNML 192 >At3g22170.1 68416.m02798 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282; contains Pfam:PF03101 domain: FAR1 family Length = 839 Score = 27.5 bits (58), Expect = 9.5 Identities = 22/73 (30%), Positives = 29/73 (39%) Frame = -2 Query: 414 DPSLHGWTHNPEILNPDDANIVEVLHTTAGLIGYDYPLGDLDFYPSGGSGQSGCLDDACS 235 D L HN E ++ V V T +G P G+L Y G + + + S Sbjct: 19 DRGLDNVLHNEEDMDIGKIEDVSVEVNTDDSVGMGVPTGELVEYTEGMNLEPLNGMEFES 78 Query: 234 HSYAYVFYAESIR 196 H AY FY E R Sbjct: 79 HGEAYSFYQEYSR 91 >At1g52040.1 68414.m05871 jacalin lectin family protein nearly identical to myrosinase-binding protein homolog GI:2997767 from [Arabidopsis thaliana]; contains Pfam profile PF01419 jacalin-like lectin domain; identical to cDNA myrosinase-binding protein homolog GI:2997766 Length = 462 Score = 27.5 bits (58), Expect = 9.5 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 2 KIYSSQSLANGGLMFVKNMYIPISTSLTSIPPKMASLG 115 KI S A+ L V + PIS+SLT+ P K+ + G Sbjct: 127 KIISFHGFADSHLNSVGAYFAPISSSLTTTPNKVEAQG 164 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,726,373 Number of Sequences: 28952 Number of extensions: 303153 Number of successful extensions: 861 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 861 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1575119672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -