BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h14f (621 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23C4.19 |spt5||transcription elongation factor Spt5|Schizosa... 33 0.044 SPBC685.09 |orc2|orp2|origin recognition complex subunit Orc2|Sc... 26 3.8 SPCC1442.01 |ste6|SPCC1450.17|guanyl-nucleotide exchange factor ... 26 5.1 >SPAC23C4.19 |spt5||transcription elongation factor Spt5|Schizosaccharomyces pombe|chr 1|||Manual Length = 990 Score = 32.7 bits (71), Expect = 0.044 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 1/81 (1%) Frame = -2 Query: 254 DESVEVS-SDSFTVIVYREDGAASEGERRSHNRVDRQQQRFTDLRASPMKEVKYNIPFSQ 78 DE E+ D F + E GA G+ R H +DRQ+Q + A + E +Y + + Sbjct: 162 DEEDEIGREDGF---IEEEVGADYVGDDRRHRELDRQRQELQSVDAERLAE-EYREKYGR 217 Query: 77 IETVRCSSSAQ*QRTLNQSVH 15 +TV +S QR L SV+ Sbjct: 218 SQTVVGDTSNVPQRLLLPSVN 238 >SPBC685.09 |orc2|orp2|origin recognition complex subunit Orc2|Schizosaccharomyces pombe|chr 2|||Manual Length = 535 Score = 26.2 bits (55), Expect = 3.8 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = +3 Query: 129 VSEPLLLSVNSIMTSSFSLARRTIFTIHN-HGETVAGNFNAFVIPAHLAAEDVNVIA 296 VS+ L+ S++ I + SFSL + +F +HN GE++ + A ++++V IA Sbjct: 316 VSDMLIQSLSIINSPSFSLG-KIVFLVHNIDGESLIDERFQSALAAIASSKNVYFIA 371 >SPCC1442.01 |ste6|SPCC1450.17|guanyl-nucleotide exchange factor Ste6|Schizosaccharomyces pombe|chr 3|||Manual Length = 911 Score = 25.8 bits (54), Expect = 5.1 Identities = 17/72 (23%), Positives = 31/72 (43%) Frame = +3 Query: 69 SFNLGERDVVFHLFHRGSPQVSEPLLLSVNSIMTSSFSLARRTIFTIHNHGETVAGNFNA 248 S N G+ + H F+R S + + LL+ S + ++ F + F Sbjct: 545 SLNFGKISFISHEFYRVSKRFLDILLIWFESYLVEELDNSKSIFFLF-----KIYKVFEV 599 Query: 249 FVIPAHLAAEDV 284 FV+P +AE++ Sbjct: 600 FVVPHFASAEEL 611 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,360,179 Number of Sequences: 5004 Number of extensions: 44989 Number of successful extensions: 134 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 273658928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -