BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h14f (621 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0607 + 19168164-19168358,19168594-19168716,19168791-191689... 29 3.0 05_03_0281 + 11560402-11560569,11561373-11561579,11562966-115631... 29 3.9 04_04_0116 + 22877296-22877482,22877578-22877627,22879057-228791... 29 3.9 01_01_1060 - 8363272-8365912,8366375-8366443,8366479-8366843,836... 28 5.2 10_06_0124 + 11013346-11013474,11013879-11013939,11014751-110148... 27 9.1 >10_08_0607 + 19168164-19168358,19168594-19168716,19168791-19168946, 19169129-19169314,19169467-19169583,19169721-19169774, 19169854-19169925,19170430-19170535,19170658-19170754, 19171090-19171184,19172318-19172420,19172699-19172886, 19174928-19175183,19177187-19177325 Length = 628 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 62 SVQFQFGRTGCCISPLSSGKPSGQ*TVVAVCQLYYDFFV 178 ++ FQ+G SPL + K +G+ V Q DFF+ Sbjct: 275 AIGFQYGSPDAVCSPLINAKKTGRSLVETYAQYVQDFFI 313 >05_03_0281 + 11560402-11560569,11561373-11561579,11562966-11563174, 11563261-11563309,11563611-11563673,11563799-11565472 Length = 789 Score = 28.7 bits (61), Expect = 3.9 Identities = 19/62 (30%), Positives = 35/62 (56%) Frame = -2 Query: 248 SVEVSSDSFTVIVYREDGAASEGERRSHNRVDRQQQRFTDLRASPMKEVKYNIPFSQIET 69 S++ +SD T I +E G +G+ +SH+ T+ A+P K++K ++ S ++T Sbjct: 601 SLQENSDGLT-ITSKEGGRKKKGKGKSHD--------VTETSAAPAKDMKDSLADSFLDT 651 Query: 68 VR 63 VR Sbjct: 652 VR 653 >04_04_0116 + 22877296-22877482,22877578-22877627,22879057-22879180, 22879266-22879373,22879462-22880084 Length = 363 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/44 (25%), Positives = 20/44 (45%) Frame = -2 Query: 320 FRSRTPVDGDYVYIFSGEVSGYDESVEVSSDSFTVIVYREDGAA 189 FR TP+ + G ++GYD + + + + DGA+ Sbjct: 245 FRHPTPIGARIRQVMGGRIAGYDINYVIDGEGMRKVAAARDGAS 288 >01_01_1060 - 8363272-8365912,8366375-8366443,8366479-8366843, 8367403-8367550,8367630-8367873,8368105-8368407, 8368639-8368851,8368927-8369002,8369533-8369561, 8369610-8369984,8371784-8371927,8374053-8374086 Length = 1546 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 477 SNQPIPHIIALDPSLHGWTHNPEILNPDDANIVEVLHTTAG 599 S P+P+ + + L GW PE + AN+ V+ TAG Sbjct: 1080 SPDPVPYKLLAEKEL-GWGGPPEFSTDNPANMASVMGGTAG 1119 >10_06_0124 + 11013346-11013474,11013879-11013939,11014751-11014838, 11017619-11017806,11017849-11018112,11018188-11018262, 11018263-11019698 Length = 746 Score = 27.5 bits (58), Expect = 9.1 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = -2 Query: 524 VERWVQSNNVRNRLV*ISSCDTSDVSTETKSDNANKLGIVAEGCSQDIDEFS 369 V+ W +S RN+ + +SS + ++A L + CS+DI + S Sbjct: 539 VKIWCKSATKRNKSISLSSAIQKFIENGNDPNDARSLSVDFSECSEDILQIS 590 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,610,914 Number of Sequences: 37544 Number of extensions: 308025 Number of successful extensions: 903 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 890 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 902 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1502076244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -