BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h14f (621 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016428-6|AAK71396.2| 1733|Caenorhabditis elegans Hypothetical ... 29 2.0 Z71177-7|CAI46554.1| 351|Caenorhabditis elegans Hypothetical pr... 29 2.7 U64848-5|AAB04884.1| 330|Caenorhabditis elegans Hypothetical pr... 28 6.2 >AF016428-6|AAK71396.2| 1733|Caenorhabditis elegans Hypothetical protein T05C3.2 protein. Length = 1733 Score = 29.5 bits (63), Expect = 2.0 Identities = 20/85 (23%), Positives = 38/85 (44%), Gaps = 5/85 (5%) Frame = +3 Query: 66 YSFNLGERDVVFHLFHRGSP-QVSEPLLLSVNSIMTSSFSLARRTIFTIHNH----GETV 230 Y ++ ER+VV + +P + + +N+I S A + + HNH + + Sbjct: 292 YFMSVTEREVVHGILKVKNPNEHCLCYIRHINNIALSQMKTASKFVDIAHNHVNSEAQKL 351 Query: 231 AGNFNAFVIPAHLAAEDVNVIAVDW 305 N +PA LA +++ V+W Sbjct: 352 LANLRDERVPAKLAMQNIRRSTVEW 376 >Z71177-7|CAI46554.1| 351|Caenorhabditis elegans Hypothetical protein AC3.10 protein. Length = 351 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 13 KCTDWLSVRCYCALLLQRTVSIWENGMLYFTSFIGEALRS 132 K T W+ RC LL + + +W + +Y T IG ++S Sbjct: 19 KITGWILTRCLNVLLFIQLILLWWSLYMYVTVTIGYYVQS 58 >U64848-5|AAB04884.1| 330|Caenorhabditis elegans Hypothetical protein C50E3.9 protein. Length = 330 Score = 27.9 bits (59), Expect = 6.2 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = +2 Query: 11 ENVRTG*VCAVTVRCYCSVQFQFGRTGCCISPLSSGKPSGQ*TVVAVCQLYYDF 172 ++V+T + +++ C V+ F CIS + KPS ++V LY D+ Sbjct: 132 KDVKTS-ISMLSLSCSIGVRILFSTVAICISLVYGSKPSLIKSIVLQLSLYLDY 184 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,260,057 Number of Sequences: 27780 Number of extensions: 261127 Number of successful extensions: 813 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 813 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1353389824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -