BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h12r (797 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 25 0.81 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 25 0.81 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 5.7 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 5.7 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 7.6 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 7.6 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 25.0 bits (52), Expect = 0.81 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 327 TTSQRWSRGSTPRSLSTSRANNHHIKP 407 T +Q WSRG+T SL S + + P Sbjct: 18 TQAQHWSRGNTWLSLDNSNMSMSSVGP 44 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 25.0 bits (52), Expect = 0.81 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 327 TTSQRWSRGSTPRSLSTSRANNHHIKP 407 T +Q WSRG+T SL S + + P Sbjct: 18 TQAQHWSRGNTWLSLDNSNMSMSSVGP 44 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -2 Query: 364 RGVLPRDQRWDVVVDLFFYRDPEESEKDEQQAK 266 R +LPR ++ + LF Y P SE ++ ++ Sbjct: 603 RLLLPRGKKEGMPFQLFLYVSPVSSEYNQYNSR 635 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -2 Query: 364 RGVLPRDQRWDVVVDLFFYRDPEESEKDEQQAK 266 R +LPR ++ + LF Y P SE ++ ++ Sbjct: 603 RLLLPRGKKEGMPFQLFLYVSPVSSEYNQYNSR 635 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 7.6 Identities = 6/30 (20%), Positives = 16/30 (53%) Frame = -2 Query: 550 VLDPAQDHQPITEASYVNIPVIALCNTDSP 461 ++DP ++++ E + IP++ + P Sbjct: 167 IVDPVEENETYDEFDTIRIPIVRSLSKSPP 196 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.8 bits (44), Expect = 7.6 Identities = 9/38 (23%), Positives = 16/38 (42%) Frame = -2 Query: 292 SEKDEQQAKEQXXXXXXXXXXXXVHEDWNETLEPVASW 179 +++ +QQ ++Q + W EP ASW Sbjct: 437 AQQPQQQQQQQQQQQQQQQQQQQQQQHWPMEEEPAASW 474 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 215,715 Number of Sequences: 438 Number of extensions: 4680 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -