BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h12f (616 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) 313 6e-86 SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_99| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_57493| Best HMM Match : Surf_Ag_VNR (HMM E-Value=0.00037) 31 0.98 SB_58902| Best HMM Match : TNFR_c6 (HMM E-Value=0.032) 29 3.0 SB_54185| Best HMM Match : Gal_Lectin (HMM E-Value=2.3) 29 3.0 SB_43606| Best HMM Match : Y_phosphatase (HMM E-Value=3.9e-26) 29 3.0 SB_37694| Best HMM Match : PSI_PsaE (HMM E-Value=7.4) 29 4.0 SB_49599| Best HMM Match : DDE (HMM E-Value=3.7e-20) 28 5.2 SB_41665| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_36758| Best HMM Match : NACHT (HMM E-Value=0.00044) 28 6.9 SB_6137| Best HMM Match : NACHT (HMM E-Value=0.00017) 28 6.9 SB_49920| Best HMM Match : MANEC (HMM E-Value=0.73) 27 9.1 SB_44668| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-05) 27 9.1 SB_36649| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_28360| Best HMM Match : Phosphodiest (HMM E-Value=0) 27 9.1 SB_38843| Best HMM Match : Dickkopf_N (HMM E-Value=0.28) 27 9.1 >SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) Length = 328 Score = 313 bits (769), Expect = 6e-86 Identities = 143/185 (77%), Positives = 163/185 (88%) Frame = +3 Query: 60 MSGGLDVLALNEEDVTKMLAATTHLGAENVNFQMETYVYKRRADGTHVINLRRTWEKLVL 239 MSGGLD+L L EEDV K LAA HLGA N +FQME YVYKR++DG ++IN+++TWEKL+L Sbjct: 1 MSGGLDILQLKEEDVVKFLAAGVHLGANNCDFQMEDYVYKRKSDGVNIINVKKTWEKLLL 60 Query: 240 AARAVVAIENPADVFVISSRPFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPR 419 AAR +V IENPADV VIS+RP+GQRA+LK+A+HTGATPIAGRFTPG FTNQIQAAFREPR Sbjct: 61 AARIIVTIENPADVCVISARPYGQRAILKYASHTGATPIAGRFTPGTFTNQIQAAFREPR 120 Query: 420 LLIVLDPAQDHQPITEASYVNIPVIALCNTDSPLRFVDIAIPCNTKSSHSIGLMWWLLAR 599 LLIV DP DHQP+TEASYVNIPVIA CNTDSPLR VD+AIPCN K HSIGLM+WLLAR Sbjct: 121 LLIVCDPRIDHQPVTEASYVNIPVIAFCNTDSPLRHVDVAIPCNNKGIHSIGLMFWLLAR 180 Query: 600 EVLRL 614 EVLR+ Sbjct: 181 EVLRM 185 >SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 33.9 bits (74), Expect = 0.11 Identities = 32/109 (29%), Positives = 43/109 (39%), Gaps = 5/109 (4%) Frame = +2 Query: 233 CSGCSCCRSHREPR*CVRHLITALRSACCTEVC--RAHRCYA---YCGTFHTRCFY*PDP 397 CS C R CV I L + C C + H A C H+ C Sbjct: 822 CSTCEGGNGLRNCSACVAPFI--LLDSYCVRECPQKGHFLNAKLRQCKKCHSSC-----S 874 Query: 398 SCIP*TSSLDCIGPCTRPSTHY*SFICQHSCDCFVQHRLPTKICGHCYP 544 SCI S+ DCI C+ PS F C+ +C T++C +C+P Sbjct: 875 SCIG-PSANDCI-TCSDPSNALIGFTCKANCTPGQFKNTATRVCENCHP 921 >SB_99| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 31.1 bits (67), Expect = 0.74 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = -3 Query: 506 VAQSNHRNVDI*SFSNGLMVLCRVQYNQETRFTECSLDLVSKSTWCETSRNRRST 342 V SN +V + N + CR Q NQ T FT + ++ C+T RN RS+ Sbjct: 876 VYNSNKGSVRVHPSDNSGSLNCRKQTNQTTAFTWPGVVNLTWKRGCQTMRNMRSS 930 >SB_57493| Best HMM Match : Surf_Ag_VNR (HMM E-Value=0.00037) Length = 432 Score = 30.7 bits (66), Expect = 0.98 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +3 Query: 432 LDPAQDHQPITEASYVNIPVIALCNTDSPLRF 527 LDP +HQPIT+ + I ++A TD+PL+F Sbjct: 119 LDPDVEHQPITDRAEACICLVA---TDAPLKF 147 >SB_58902| Best HMM Match : TNFR_c6 (HMM E-Value=0.032) Length = 397 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +2 Query: 413 TSSLDCIGPCTRPSTHY*SFICQHSCDCFVQHRLPTKICGHC 538 TSSLD + PC+ S H+ + + C C+ +++ C C Sbjct: 331 TSSLDTLAPCSF-SCHFACDVNTNQCICYYGYQMSDNKCKAC 371 >SB_54185| Best HMM Match : Gal_Lectin (HMM E-Value=2.3) Length = 225 Score = 29.1 bits (62), Expect = 3.0 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = -3 Query: 506 VAQSNHRNVDI*SFSNGLMVLCRVQYNQETRFTECSLDLVSKSTWCETSRNRR 348 V SN +V + N + CR Q NQ T FT + ++ C+T RN R Sbjct: 155 VYNSNKGSVRVHPSDNSGSLNCRKQTNQTTAFTWPGVVNLTWKRGCQTMRNMR 207 >SB_43606| Best HMM Match : Y_phosphatase (HMM E-Value=3.9e-26) Length = 280 Score = 29.1 bits (62), Expect = 3.0 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = -3 Query: 506 VAQSNHRNVDI*SFSNGLMVLCRVQYNQETRFTECSLDLVSKSTWCETSRNRR 348 V SN +V + N + CR Q NQ T FT + ++ C+T RN R Sbjct: 196 VYNSNKGSVRVHPSDNSGSLNCRKQTNQTTAFTWPGVVNLTWKRGCQTMRNMR 248 >SB_37694| Best HMM Match : PSI_PsaE (HMM E-Value=7.4) Length = 158 Score = 28.7 bits (61), Expect = 4.0 Identities = 17/53 (32%), Positives = 30/53 (56%) Frame = +1 Query: 259 PSRTPLMCSSSHHGPSVSVLY*SLPRTPVLRLLRDVSHQVLLLTRSKLHSVNL 417 PSRTPL ++ +G +S+ Y VLR+ R H ++ ++R L ++N+ Sbjct: 49 PSRTPLSQHNNGYGLRISI-YAVRYTAMVLRINRFALHIIVTVSRITLSAINV 100 >SB_49599| Best HMM Match : DDE (HMM E-Value=3.7e-20) Length = 428 Score = 28.3 bits (60), Expect = 5.2 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +3 Query: 408 REPR-LLIVLDPAQDHQPITEASYVNIPVIALC-NTDSPLRFVDIAIPCNTK 557 RE R +++ +D A H P + +Y NI +I L NT S + +D I N K Sbjct: 255 RENRNIMLFMDNAPCHTPSLKNTYCNIKIIFLSKNTTSKTQPLDSGIIANWK 306 >SB_41665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 657 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/45 (28%), Positives = 18/45 (40%) Frame = +2 Query: 227 KTCSGCSCCRSHREPR*CVRHLITALRSACCTEVCRAHRCYAYCG 361 +TC C+ C C +L+ C + AHRC CG Sbjct: 594 RTCGRCNVCYDAENDSVC-----DSLKHTCSDDEATAHRCSLTCG 633 >SB_36758| Best HMM Match : NACHT (HMM E-Value=0.00044) Length = 899 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 Query: 290 DDEHISGVLDGYDSTSSQNK 231 ++EHI+ VLDGYD S +K Sbjct: 60 NEEHIAFVLDGYDELPSSSK 79 >SB_6137| Best HMM Match : NACHT (HMM E-Value=0.00017) Length = 1243 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 Query: 290 DDEHISGVLDGYDSTSSQNK 231 ++EHI+ VLDGYD S +K Sbjct: 346 NEEHIAFVLDGYDELPSSSK 365 >SB_49920| Best HMM Match : MANEC (HMM E-Value=0.73) Length = 139 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +2 Query: 170 CLQTTC*WYPCD-QLASYLGKTCSGCSC 250 C+Q C CD + SY G+TC G +C Sbjct: 87 CVQRCCDVLHCDLAMMSYGGRTCYGVAC 114 >SB_44668| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-05) Length = 1604 Score = 27.5 bits (58), Expect = 9.1 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +2 Query: 287 HLITALRSACCTEVCRAHRCYAYCGTF 367 + + + R + T++ R HRC YC F Sbjct: 1549 YALVSPRESIATDIHRVHRCIGYCPQF 1575 >SB_36649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +2 Query: 257 SHREPR*CVRHLITALRSA 313 +HR PR V HL TA+RSA Sbjct: 44 AHRSPRTIVEHLDTAIRSA 62 >SB_28360| Best HMM Match : Phosphodiest (HMM E-Value=0) Length = 483 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -1 Query: 430 TIKRRGSRNAAWIWLVKAPGVKRPAIGVAPVCAANFS 320 T+++RG ++A + W +RP+ VC+ N S Sbjct: 122 TMEKRGRKSATYFWPSSTSYERRPSFFADHVCSVNCS 158 >SB_38843| Best HMM Match : Dickkopf_N (HMM E-Value=0.28) Length = 241 Score = 27.5 bits (58), Expect = 9.1 Identities = 21/67 (31%), Positives = 23/67 (34%), Gaps = 2/67 (2%) Frame = +2 Query: 248 CCRSHREPR*CVRHLITALRSACCTEVCRAH-RCYAYCGTFHTRCFY*PDPSCIP*TSSL 424 CC R C+ H L CC VC A C C H C CI S Sbjct: 16 CCCGSALKRNCLVHSDCGLAKKCCENVCLARLSCDGSCSA-HMDCDQDYGEECI--KSRC 72 Query: 425 DCI-GPC 442 C+ PC Sbjct: 73 RCVREPC 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,561,571 Number of Sequences: 59808 Number of extensions: 528482 Number of successful extensions: 1260 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1251 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -