BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h11r (775 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. 23 3.2 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 22 5.5 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 22 7.3 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 7.3 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 9.6 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 9.6 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.6 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 9.6 >DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. Length = 135 Score = 23.0 bits (47), Expect = 3.2 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -1 Query: 724 LPKLGI-QAIFNRQNSGLTKILDNDEPLYVSKAVQK-AFIE 608 + K GI + I N N G I D + LY+ A++K +F++ Sbjct: 34 MAKTGINKQIINDVNDGKINIEDENVQLYIECAMKKFSFVD 74 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.2 bits (45), Expect = 5.5 Identities = 15/52 (28%), Positives = 22/52 (42%) Frame = -2 Query: 420 AHINNERNTKKYLYYIPGVLILC*YCACVIRTQLFIYTQCNKQNKIECSHLT 265 A E+ K L + GV I+C V+ +QC Q KI + +T Sbjct: 325 AKFAKEKKAAKTLGIVMGVFIICWLPFFVVNLWSGFCSQCIWQEKIVFAAVT 376 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.8 bits (44), Expect = 7.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 20 NIFNFSFTNSY*AKIYFYNI 79 NI N++ N+Y K+Y YNI Sbjct: 92 NISNYNNNNNYNKKLY-YNI 110 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.8 bits (44), Expect = 7.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 20 NIFNFSFTNSY*AKIYFYNI 79 NI N++ N+Y K+Y YNI Sbjct: 330 NISNYNNNNNYNKKLY-YNI 348 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +2 Query: 395 VFLSLLMCALNLFIIF 442 VFLSLL+ AL L+ I+ Sbjct: 14 VFLSLLIPALILYFIY 29 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = -2 Query: 453 YTVGKMMNKFSAHINNERNTKKYLYY 376 Y N ++ + NN N K LYY Sbjct: 329 YNNNNYNNNYNNYNNNNYNNYKKLYY 354 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +1 Query: 157 YNTFVLCTRVGWCLDKW 207 Y T +CT +G+ D W Sbjct: 177 YTTPSICTALGYLKDAW 193 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +1 Query: 157 YNTFVLCTRVGWCLDKW 207 Y T +CT +G+ D W Sbjct: 172 YTTPSICTALGYLKDAW 188 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 215,430 Number of Sequences: 438 Number of extensions: 4396 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -