BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10h09r (735 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 27 0.24 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 26 0.32 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 26 0.32 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 3.9 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 22 5.2 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 22 5.2 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 5.2 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 6.9 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 6.9 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 6.9 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 6.9 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 6.9 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 6.9 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 6.9 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 6.9 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 6.9 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 9.1 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 9.1 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 9.1 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 9.1 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 26.6 bits (56), Expect = 0.24 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 422 SLGNNYRARYYDGRISNDHGRNSRLFFNI 508 SL NNY Y+ +N + N +L++NI Sbjct: 84 SLSNNYNYSNYNNYNNNYNNYNKKLYYNI 112 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 26.2 bits (55), Expect = 0.32 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 362 VHWARGHNGGVSHDHRGYT 418 +HW GHNGG S GYT Sbjct: 1422 LHWKSGHNGGAS--LTGYT 1438 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 26.2 bits (55), Expect = 0.32 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 362 VHWARGHNGGVSHDHRGYT 418 +HW GHNGG S GYT Sbjct: 1418 LHWKSGHNGGAS--LTGYT 1434 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.6 bits (46), Expect = 3.9 Identities = 7/26 (26%), Positives = 15/26 (57%) Frame = +2 Query: 380 HNGGVSHDHRGYTRSLGNNYRARYYD 457 +N ++++ Y + NNY+ YY+ Sbjct: 330 NNNNYNNNYNNYNNNNYNNYKKLYYN 355 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 685 GHYESPDVGPALVEAPIVPSPVHVGPLVP 599 G++ +GP + +P H+GPL P Sbjct: 125 GNFPPRPMGPWISIQEQIPRFRHIGPLTP 153 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 5.2 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +2 Query: 398 HDHRGYTRSLGNNYRARYYD 457 H++ Y + NNY+ YY+ Sbjct: 91 HNNNNYNNNNYNNYKKLYYN 110 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 685 GHYESPDVGPALVEAPIVPSPVHVGPLVP 599 G++ +GP + +P H+GPL P Sbjct: 366 GNFPPRPMGPWISIQEQIPRFRHIGPLTP 394 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 685 GHYESPDVGPALVEAPIVPSPVHVGPLVP 599 G++ S +GP + +P H+GP P Sbjct: 130 GNFPSRPMGPWVPMQEQIPRFRHIGPSTP 158 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 685 GHYESPDVGPALVEAPIVPSPVHVGPLVP 599 G++ S +GP + +P H+GP P Sbjct: 130 GNFPSRPMGPWVPMQEQIPRFRHIGPSTP 158 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 685 GHYESPDVGPALVEAPIVPSPVHVGPLVP 599 G++ S +GP + +P H+GP P Sbjct: 130 GNFPSRPMGPWVPMQEQIPRFRHIGPSTP 158 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 685 GHYESPDVGPALVEAPIVPSPVHVGPLVP 599 G++ S +GP + +P H+GP P Sbjct: 130 GNFPSRPMGPWVPMQEQIPRFRHIGPSTP 158 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 685 GHYESPDVGPALVEAPIVPSPVHVGPLVP 599 G++ S +GP + +P H+GP P Sbjct: 130 GNFPSRPMGPWVPMQEQIPRFRHIGPSTP 158 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 685 GHYESPDVGPALVEAPIVPSPVHVGPLVP 599 G++ S +GP + +P H+GP P Sbjct: 130 GNFPSRPMGPWVPMQEQIPRFRHIGPSTP 158 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 685 GHYESPDVGPALVEAPIVPSPVHVGPLVP 599 G++ S +GP + +P H+GP P Sbjct: 130 GNFPSRPMGPWVPMQEQIPRFRHIGPSTP 158 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 685 GHYESPDVGPALVEAPIVPSPVHVGPLVP 599 G++ S +GP + +P H+GP P Sbjct: 133 GNFPSRPMGPWVPMQEQIPRFRHIGPSTP 161 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 6.9 Identities = 6/20 (30%), Positives = 12/20 (60%) Frame = +2 Query: 398 HDHRGYTRSLGNNYRARYYD 457 +++ Y + NNY+ YY+ Sbjct: 335 NNYNNYNNNYNNNYKKLYYN 354 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +2 Query: 395 SHDHRGYTRSLGNNYRARYYD 457 ++++ Y + NNYR YY+ Sbjct: 90 NYNNNNYKKLYCNNYRKLYYN 110 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 634 VPSPVHVGPLVPGQLTPLVHI 572 VP P+H G P + P + I Sbjct: 346 VPVPIHCGNFPPRPMGPWISI 366 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 65 VIWLFFYILEMISNDNWFHSDWLDGTDDDRL 157 V+ L Y+L+ S F DGT++D L Sbjct: 578 VVALVLYLLDRFSPFGRFKLANTDGTEEDAL 608 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -3 Query: 691 KRGHYESPDVG 659 KRG YE P VG Sbjct: 610 KRGKYEEPTVG 620 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,404 Number of Sequences: 438 Number of extensions: 2457 Number of successful extensions: 28 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -