BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10g24r (685 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces... 27 2.5 SPCC736.14 |dis1||microtubule-associated protein Dis1 |Schizosac... 27 3.3 >SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1155 Score = 27.1 bits (57), Expect = 2.5 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = -3 Query: 320 ELGLPSRCDQRVLLRNFRNQQ---YRSGFHHLRFRIQ 219 E GL S CD L+NF N Q + G++ + IQ Sbjct: 296 ETGLSSTCDVNCSLQNFANYQDFYFSKGYNSYQIEIQ 332 >SPCC736.14 |dis1||microtubule-associated protein Dis1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 882 Score = 26.6 bits (56), Expect = 3.3 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = -1 Query: 325 NMNWVFLRGVTNAFCSEIFVINNIVQDSTICASGYNVTSQSTCQGDSGGGL 173 N++ V NAF + +F +Q S + AS NVTS++T G L Sbjct: 189 NLSITLYAWVGNAFKTHVFPQLKQIQVSDLEASFQNVTSRTTTGGHISNSL 239 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,714,977 Number of Sequences: 5004 Number of extensions: 53098 Number of successful extensions: 140 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -