BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10g24r (685 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 29 2.6 08_02_0539 + 18338781-18339592,18347885-18349860,18350030-18350034 29 3.4 01_01_1166 + 9287840-9288040,9289752-9289799,9292166-9292282,929... 29 4.5 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 313 PNSYFQERYHWSRFFPNRWQSDGNRR 390 P S+ + H R +P RW+S G+RR Sbjct: 14 PVSWCHQDRHGRRHYPRRWRSSGSRR 39 >08_02_0539 + 18338781-18339592,18347885-18349860,18350030-18350034 Length = 930 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 274 FLSRTRWSHLEGRPNSYFQERYHWSRFFPNRWQSDGNRRSC 396 F+ TR LEG ++YF E + S P Q DG +SC Sbjct: 448 FIPETRGIPLEGVGSAYFNELINRSMIQPADVQYDGTVQSC 488 >01_01_1166 + 9287840-9288040,9289752-9289799,9292166-9292282, 9293018-9293700,9295214-9297190,9298330-9298441, 9299848-9299904 Length = 1064 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +1 Query: 274 FLSRTRWSHLEGRPNSYFQERYHWSRFFPNRWQSDGNRRSC 396 F+ R R S+LE + YF E + P R S G RSC Sbjct: 534 FIGRVRGSNLEEIADKYFDEFISRNIVTPIRIDSSGEVRSC 574 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,539,554 Number of Sequences: 37544 Number of extensions: 375461 Number of successful extensions: 937 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -