BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10g22r (657 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0115 + 27783170-27783331,27783510-27783705,27783825-27784411 33 0.15 01_01_1014 - 8022787-8023935 28 7.5 11_02_0042 - 7672565-7672729,7672902-7672977,7673409-7674132,767... 27 9.9 09_04_0302 + 16501020-16501049,16501568-16501659,16502063-165021... 27 9.9 08_01_0356 + 3131214-3132443,3132584-3132778,3132892-3132972,313... 27 9.9 04_04_0965 - 29762388-29762564,29764272-29766361,29766567-297671... 27 9.9 02_01_0107 + 785993-786359,786773-787703,787807-787975,788472-78... 27 9.9 >05_07_0115 + 27783170-27783331,27783510-27783705,27783825-27784411 Length = 314 Score = 33.5 bits (73), Expect = 0.15 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 5/61 (8%) Frame = -3 Query: 424 WCDSYLADCRLEVYSTQQ-----YAHQGHPSPASGSVTVRDCPRCGGRCRLEHRHSSVHK 260 WC+S+ +D R V S+ A G + AS +V V+ CP CG R R E +++ Sbjct: 3 WCNSF-SDVRTAVDSSLSPAAAVAAAAGKKAAASLAVLVKMCPSCGHRARYEQETTTIQD 61 Query: 259 L 257 L Sbjct: 62 L 62 >01_01_1014 - 8022787-8023935 Length = 382 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 430 HPWCDSYLADCRLEVYSTQQYAHQGHPSPASGSVTV 323 HP+ Y + L YS Y + P+PASG+ T+ Sbjct: 139 HPFAILYPGNVGLLCYSISFYVAELQPAPASGTATL 174 >11_02_0042 - 7672565-7672729,7672902-7672977,7673409-7674132, 7674684-7674708,7675041-7675486,7676643-7676862, 7677609-7678459,7678697-7679555 Length = 1121 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -1 Query: 204 SVHPSKRKHIVFSHCASVQFPKIFEIDLIC 115 ++ P V S C F KI +ID++C Sbjct: 487 TIDPENLPRAVISRCQKYMFSKIKDIDIVC 516 >09_04_0302 + 16501020-16501049,16501568-16501659,16502063-16502198, 16502297-16502727,16502950-16503028 Length = 255 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -3 Query: 424 WCDSYLADCRLEVYSTQQYAHQGHPSPAS 338 W ++Y D +E+Y+ Q++ HQ P PA+ Sbjct: 54 WAENY--DKVMELYNVQRFNHQAVPLPAT 80 >08_01_0356 + 3131214-3132443,3132584-3132778,3132892-3132972, 3133324-3133383,3133466-3133560,3133660-3133816, 3133896-3134021,3134398-3134478,3134557-3134647, 3134735-3134868,3135068-3135136,3135219-3135308, 3135405-3135508,3135594-3135762,3136066-3136134 Length = 916 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 346 DSDGPDAHTVGCCIPQVDNL 405 + D +A TVGCC +VDN+ Sbjct: 647 EKDEDEAETVGCCTLKVDNV 666 >04_04_0965 - 29762388-29762564,29764272-29766361,29766567-29767170, 29768395-29768637,29768704-29770203 Length = 1537 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -3 Query: 385 YSTQQYAHQGHPSPASGSVTVRDCPRCGGRCR 290 Y Q G PA+ S R C GG CR Sbjct: 1371 YQPQHVEISGGEQPAAASCVFRPCEAAGGGCR 1402 >02_01_0107 + 785993-786359,786773-787703,787807-787975,788472-788588, 788815-788961 Length = 576 Score = 27.5 bits (58), Expect = 9.9 Identities = 17/68 (25%), Positives = 31/68 (45%) Frame = +1 Query: 169 KDDMLSFGWVDRSAEASPNLYIKVKSSAR*VYEPKSDGVPADTAPHNADSREL*RSHLPD 348 +DD + GW+ + ++ Y++ K+ + E + + AP D + L + L Sbjct: 250 EDDENNEGWLPAVSRSTHRRYLRRKARRDALKESEQSIETSSAAPSIDDDKILSENGLNP 309 Query: 349 SDGPDAHT 372 DGP A T Sbjct: 310 VDGPSADT 317 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,582,884 Number of Sequences: 37544 Number of extensions: 370862 Number of successful extensions: 950 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 925 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 950 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -