BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10g22f (661 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0115 + 27783170-27783331,27783510-27783705,27783825-27784411 33 0.15 01_01_1014 - 8022787-8023935 28 7.6 >05_07_0115 + 27783170-27783331,27783510-27783705,27783825-27784411 Length = 314 Score = 33.5 bits (73), Expect = 0.15 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 5/61 (8%) Frame = +3 Query: 234 WCDSYLADCRLEVYSTQQ-----YAHQGHPSPASGSVTVRDCPRCGGRCRLEHRHSSVHK 398 WC+S+ +D R V S+ A G + AS +V V+ CP CG R R E +++ Sbjct: 3 WCNSF-SDVRTAVDSSLSPAAAVAAAAGKKAAASLAVLVKMCPSCGHRARYEQETTTIQD 61 Query: 399 L 401 L Sbjct: 62 L 62 >01_01_1014 - 8022787-8023935 Length = 382 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 228 HPWCDSYLADCRLEVYSTQQYAHQGHPSPASGSVTV 335 HP+ Y + L YS Y + P+PASG+ T+ Sbjct: 139 HPFAILYPGNVGLLCYSISFYVAELQPAPASGTATL 174 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,636,315 Number of Sequences: 37544 Number of extensions: 371617 Number of successful extensions: 949 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 924 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 949 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -