BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10g20f (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 pr... 24 3.6 AY825922-1|AAV70485.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825921-1|AAV70484.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825920-1|AAV70483.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825919-1|AAV70482.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825918-1|AAV70481.1| 161|Anopheles gambiae male sterility pro... 23 6.3 AY825917-1|AAV70480.1| 161|Anopheles gambiae male sterility pro... 23 6.3 AY825916-1|AAV70479.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825915-1|AAV70478.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825914-1|AAV70477.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825913-1|AAV70476.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825912-1|AAV70475.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825911-1|AAV70474.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825910-1|AAV70473.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825909-1|AAV70472.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825908-1|AAV70471.1| 168|Anopheles gambiae male sterility pro... 23 6.3 AY825907-1|AAV70470.1| 168|Anopheles gambiae male sterility pro... 23 6.3 AY825906-1|AAV70469.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825905-1|AAV70468.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825904-1|AAV70467.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825903-1|AAV70466.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825902-1|AAV70465.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825901-1|AAV70464.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825900-1|AAV70463.1| 148|Anopheles gambiae male sterility pro... 23 6.3 AY825899-1|AAV70462.1| 148|Anopheles gambiae male sterility pro... 23 6.3 AY825898-1|AAV70461.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825897-1|AAV70460.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825896-1|AAV70459.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825895-1|AAV70458.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825894-1|AAV70457.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825893-1|AAV70456.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825892-1|AAV70455.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825891-1|AAV70454.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825890-1|AAV70453.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825889-1|AAV70452.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825888-1|AAV70451.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825887-1|AAV70450.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825886-1|AAV70449.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825885-1|AAV70448.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825884-1|AAV70447.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825883-1|AAV70446.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825882-1|AAV70445.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825881-1|AAV70444.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825880-1|AAV70443.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AY825879-1|AAV70442.1| 167|Anopheles gambiae male sterility pro... 23 6.3 AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 23 6.3 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 23 8.3 >AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 24.2 bits (50), Expect = 3.6 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = -2 Query: 581 FCRSSYFSVCLHHVSIMSHILLFALIL 501 FC S ++CLH +S ++++ L++ Sbjct: 19 FCELSLRAICLHTLSALNNLHYMELVI 45 >AY825922-1|AAV70485.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825921-1|AAV70484.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825920-1|AAV70483.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825919-1|AAV70482.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825918-1|AAV70481.1| 161|Anopheles gambiae male sterility protein protein. Length = 161 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 14 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 42 >AY825917-1|AAV70480.1| 161|Anopheles gambiae male sterility protein protein. Length = 161 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 14 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 42 >AY825916-1|AAV70479.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825915-1|AAV70478.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825914-1|AAV70477.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825913-1|AAV70476.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825912-1|AAV70475.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825911-1|AAV70474.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825910-1|AAV70473.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825909-1|AAV70472.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825908-1|AAV70471.1| 168|Anopheles gambiae male sterility protein protein. Length = 168 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825907-1|AAV70470.1| 168|Anopheles gambiae male sterility protein protein. Length = 168 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825906-1|AAV70469.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825905-1|AAV70468.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825904-1|AAV70467.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825903-1|AAV70466.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825902-1|AAV70465.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825901-1|AAV70464.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825900-1|AAV70463.1| 148|Anopheles gambiae male sterility protein protein. Length = 148 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825899-1|AAV70462.1| 148|Anopheles gambiae male sterility protein protein. Length = 148 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825898-1|AAV70461.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825897-1|AAV70460.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825896-1|AAV70459.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825895-1|AAV70458.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825894-1|AAV70457.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825893-1|AAV70456.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825892-1|AAV70455.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825891-1|AAV70454.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825890-1|AAV70453.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825889-1|AAV70452.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825888-1|AAV70451.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825887-1|AAV70450.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825886-1|AAV70449.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 16 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 44 >AY825885-1|AAV70448.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 16 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 44 >AY825884-1|AAV70447.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825883-1|AAV70446.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825882-1|AAV70445.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825881-1|AAV70444.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825880-1|AAV70443.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AY825879-1|AAV70442.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 151 AIKHPLEHTWSYWLYTNKSKEWIHNLVEL 237 A+++P +H Y + ++ +H LVEL Sbjct: 17 AVRNPTKHVLLYPGFQFRTNRLVHKLVEL 45 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 23.4 bits (48), Expect = 6.3 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -3 Query: 322 CNLVHGLTLKVVSCSGINTSNLLQ*RMLIIQPSCVSILYSYLCKASSS 179 C + LTL SC +++L + PS ++Y Y+CK++ + Sbjct: 42 CIIALSLTLSSSSCK--QSTSLSFVFLCCCVPSSERLIYYYMCKSTKN 87 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 23.0 bits (47), Expect = 8.3 Identities = 6/15 (40%), Positives = 12/15 (80%) Frame = -1 Query: 474 MFEIFTDHQQDQIQP 430 +F + +DH+QD++ P Sbjct: 612 LFAMLSDHEQDRVNP 626 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 661,368 Number of Sequences: 2352 Number of extensions: 12561 Number of successful extensions: 75 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -