BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10g17r (514 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 27 0.13 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 23 1.2 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 1.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 1.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 1.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 1.6 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 22 3.7 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 26.6 bits (56), Expect = 0.13 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -3 Query: 467 RCFRCYRSCGCRQPHQAHFRTRNHRFPSSRRWC 369 +C C+R C+ Q H+RT P + C Sbjct: 136 QCVICHRVLSCKSALQMHYRTHTGERPFKCKIC 168 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 23.4 bits (48), Expect = 1.2 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -1 Query: 301 LVQIIVNVNQPGADAAIIPQPVIVDESDE 215 +V +I N+ PG+D P P + +E Sbjct: 402 IVHLIANLPSPGSDQRSTPSPRVYGNVNE 430 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.6 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +2 Query: 275 VHVHNDLNERSGLAWCDWSNDNGGGHDWLSDSTTVGKRE 391 V + L + G+ D+ ND+G G D + T+ E Sbjct: 1384 VEIVKQLQKLQGIDDGDYENDSGSGPDRIGRRKTIHNLE 1422 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.6 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +2 Query: 275 VHVHNDLNERSGLAWCDWSNDNGGGHDWLSDSTTVGKRE 391 V + L + G+ D+ ND+G G D + T+ E Sbjct: 1384 VEIVKQLQKLQGIDDGDYENDSGSGPDRIGRRKTIHNLE 1422 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.6 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +2 Query: 275 VHVHNDLNERSGLAWCDWSNDNGGGHDWLSDSTTVGKRE 391 V + L + G+ D+ ND+G G D + T+ E Sbjct: 1384 VEIVKQLQKLQGIDDGDYENDSGSGPDRIGRRKTIHNLE 1422 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.6 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +2 Query: 275 VHVHNDLNERSGLAWCDWSNDNGGGHDWLSDSTTVGKRE 391 V + L + G+ D+ ND+G G D + T+ E Sbjct: 1384 VEIVKQLQKLQGIDDGDYENDSGSGPDRIGRRKTIHNLE 1422 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 225 SPMKSNPTPLLSP 187 SP PTP++SP Sbjct: 311 SPYSGTPTPMMSP 323 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,881 Number of Sequences: 336 Number of extensions: 1597 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12258909 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -