BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10g17r (514 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g05805.1 68414.m00607 basic helix-loop-helix (bHLH) family pr... 29 2.4 At2g27060.1 68415.m03251 leucine-rich repeat transmembrane prote... 27 5.6 At1g65440.1 68414.m07424 glycine-rich protein 27 5.6 At4g29440.1 68417.m04203 expressed protein contains Pfam profil... 27 7.4 At4g27870.1 68417.m04001 integral membrane family protein contai... 27 9.8 At2g39810.1 68415.m04890 expressed protein 27 9.8 At1g42430.1 68414.m04893 expressed protein 27 9.8 >At1g05805.1 68414.m00607 basic helix-loop-helix (bHLH) family protein Length = 362 Score = 28.7 bits (61), Expect = 2.4 Identities = 24/85 (28%), Positives = 37/85 (43%) Frame = +2 Query: 194 NNGVGFDFIGLVNNDGLRNDSSISSWLVHVHNDLNERSGLAWCDWSNDNGGGHDWLSDST 373 +N +G F G ++ LR+DS+ V+N + + L +N+N D D + Sbjct: 60 DNFIGNFFTGAADSSSLRSDSTTCG----VNNSSDGQKQLGN---NNNNNSNKDIFLDRS 112 Query: 374 TVGKREIDDFGCENGLGGVGDSHSY 448 G EI N +GG S SY Sbjct: 113 YGGFNEISQQHKSNDIGGGNSSGSY 137 >At2g27060.1 68415.m03251 leucine-rich repeat transmembrane protein kinase, putative Length = 1007 Score = 27.5 bits (58), Expect = 5.6 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 329 SNDNGGGHDWLSDSTTVGKREIDDFG-CENGLGGV 430 SN+N G L D++TVG + + G N LGGV Sbjct: 425 SNNNFSGSLPLQDASTVGNLSLTNIGLSHNSLGGV 459 >At1g65440.1 68414.m07424 glycine-rich protein Length = 1647 Score = 27.5 bits (58), Expect = 5.6 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +2 Query: 326 WSNDNGGGHD--WLSDSTTVGKREIDDFGCENGLGGVGDSHSYDS 454 W + +GGG W +DS GK+ +D G +G GG G +S Sbjct: 1563 WGSGSGGGGSGGWGNDSG--GKKSSEDGGFGSGSGGGGSDWGNES 1605 >At4g29440.1 68417.m04203 expressed protein contains Pfam profile: PF03398 eukaryotic protein of unknown function, DUF292 Length = 1090 Score = 27.1 bits (57), Expect = 7.4 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 200 GVGFDFIGLVNNDGLRNDSSISSWLVHVHNDLNERS 307 G+GF +G + + ISSW + H DL + S Sbjct: 532 GLGFSLLGSSSKTSDHMPTEISSWSLEGHKDLGKLS 567 >At4g27870.1 68417.m04001 integral membrane family protein contains Pfam PF01988: Integral membrane protein Length = 761 Score = 26.6 bits (56), Expect = 9.8 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +2 Query: 338 NGGGHDWLSDSTTVGKREIDDFGCENGLGGVGDSHSYDSNESNE 469 +G GHD DS+T+ +G GG ++ + SN E Sbjct: 40 HGKGHDTSVDSSTITNTSSSSSSSFSGDGGTEETPDFHSNGDGE 83 >At2g39810.1 68415.m04890 expressed protein Length = 865 Score = 26.6 bits (56), Expect = 9.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 329 SNDNGGGHDWLSDSTTVGKREIDDFG 406 S +N GG W SD T+ + E+ FG Sbjct: 825 SRNNSGGLRWRSDETSDDEDELTSFG 850 >At1g42430.1 68414.m04893 expressed protein Length = 435 Score = 26.6 bits (56), Expect = 9.8 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 1/77 (1%) Frame = +2 Query: 227 VNNDGLRNDSSISSWLVHVHNDLNERSGLAWCDWSNDNGGGHDWLSDSTTVGKREIDDFG 406 VN G D S SW +DL + +G C WS G HD S+ T + D G Sbjct: 141 VNEAGTNEDGS--SWFRESGHDLGD-NGYR-CRWSRMGGRSHDGSSEWTETWWEKSDWTG 196 Query: 407 C-ENGLGGVGDSHSYDS 454 E G+ G + DS Sbjct: 197 YKELGVEKSGKNSEGDS 213 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,778,269 Number of Sequences: 28952 Number of extensions: 160691 Number of successful extensions: 506 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -