BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10g17f (554 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0309 - 20713774-20713818,20713838-20713915,20714044-207142... 31 0.82 02_02_0444 + 10340927-10341063,10341157-10341241,10341480-103415... 29 2.5 12_02_1153 + 26524232-26524474,26524563-26524694 29 3.3 01_06_0100 - 26424769-26425545,26425666-26425697,26425778-264258... 28 5.8 >01_05_0309 - 20713774-20713818,20713838-20713915,20714044-20714222, 20714296-20714556,20715222-20715393,20715501-20715662, 20716435-20716863,20717729-20717785,20717872-20718842, 20719098-20719182,20719269-20719637,20719756-20720001, 20720090-20720362,20720663-20720827,20721328-20721556, 20721727-20722168,20723152-20724138,20724352-20724517, 20725070-20725728,20725820-20726186 Length = 2113 Score = 30.7 bits (66), Expect = 0.82 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 12 SLQANKIKNEILRCFRCYRSC 74 S+QANKI N +L C C +SC Sbjct: 742 SMQANKISNTLLECSFCGKSC 762 >02_02_0444 + 10340927-10341063,10341157-10341241,10341480-10341537, 10343738-10345885,10345943-10346388 Length = 957 Score = 29.1 bits (62), Expect = 2.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 180 DNGGGHDWLSDSTTVG 133 D GGG DWL D TVG Sbjct: 870 DGGGGGDWLYDGATVG 885 Score = 28.7 bits (61), Expect = 3.3 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -3 Query: 180 DNGGGHDWLSDSTTVGKREIDDFGCENGLGGVGD 79 D GGG DWL D TVG + L G GD Sbjct: 830 DEGGGGDWLYDGGTVGGLYGGGEAVDGVLDGGGD 863 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -3 Query: 180 DNGGGHDWLSDSTTVGKREIDDFGCENGLGGVGD 79 D GGG WL D TVG + GL G G+ Sbjct: 460 DEGGGGGWLYDGATVGGLDEGGGVVGGGLDGGGE 493 Score = 27.9 bits (59), Expect = 5.8 Identities = 27/79 (34%), Positives = 31/79 (39%) Frame = -3 Query: 327 GDNNGVGFDFIGLVNNDGLRNDSSISSWLVHVHNDLNERSGLAWCDWSNDNGGGHDWLSD 148 GD G G D G V GL ++ WL G D GGG WL D Sbjct: 588 GDVVGGGLDGGGEVLGGGL-DEGGGGGWLYDGATVGGLDGGGDVVGGGLDGGGG--WLYD 644 Query: 147 STTVGKREIDDFGCENGLG 91 TVG +D+ GC G G Sbjct: 645 GATVG--GLDEGGCVEGGG 661 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -3 Query: 180 DNGGGHDWLSDSTTVGKREIDDFGCENGLGGVGD 79 D GGG WL D TVG + GL G G+ Sbjct: 128 DEGGGGGWLYDGATVGGLDGGGDVVGGGLDGGGE 161 >12_02_1153 + 26524232-26524474,26524563-26524694 Length = 124 Score = 28.7 bits (61), Expect = 3.3 Identities = 29/94 (30%), Positives = 41/94 (43%), Gaps = 4/94 (4%) Frame = -3 Query: 348 GAFFSLFGDNNGVGFDFIGLVNN-DGLRNDSSISSWLVHVHNDLNERSGLAWCDWSNDNG 172 GA + GD +G G +GL + G R + S S ER LAW ++ +G Sbjct: 2 GAAIVVSGDESGGGSS-LGLGGSITGTRENRSTQSG-----RGRWERRRLAWAAGASGSG 55 Query: 171 GGHDWLSDSTTVGKREIDDFG---CENGLGGVGD 79 G D D+ G + DD G C + G+GD Sbjct: 56 GSRD--DDNDVSGGDDDDDGGGGDCNDDAVGIGD 87 >01_06_0100 - 26424769-26425545,26425666-26425697,26425778-26425894, 26426067-26426118,26426229-26426281,26426883-26427585 Length = 577 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = -3 Query: 177 NGGGHD---WLSDSTTVGKREIDDFGCENGLGGVGDS 76 N G +D W++D VG +DD G ++ +GD+ Sbjct: 541 NPGDYDDEGWITDEDMVGGIALDDLGLDSSSSDIGDA 577 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,205,334 Number of Sequences: 37544 Number of extensions: 233554 Number of successful extensions: 693 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 692 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1257681096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -