BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10g16r (652 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8ABP5 Cluster: Alpha-galactosidase; n=1; Bacteroides t... 34 3.4 UniRef50_Q8G6G7 Cluster: Possible cell surface protein with gram... 33 4.5 UniRef50_Q5KQY6 Cluster: Galactoside O-acetyltransferase; n=3; K... 33 5.9 UniRef50_A5K5G4 Cluster: Putative uncharacterized protein; n=1; ... 33 7.8 >UniRef50_Q8ABP5 Cluster: Alpha-galactosidase; n=1; Bacteroides thetaiotaomicron|Rep: Alpha-galactosidase - Bacteroides thetaiotaomicron Length = 845 Score = 33.9 bits (74), Expect = 3.4 Identities = 30/132 (22%), Positives = 51/132 (38%), Gaps = 10/132 (7%) Frame = +2 Query: 233 VNNDGLGNDSCISAWLVHVHNDLNERSGLAWCDWSNDNRGGHDWLSDSTTVG-------- 388 + G + C+ + + E S WC WS+ G D D ++ Sbjct: 681 IRGSGQSSSDCVYNQAGGLTSTEAETSFAMWCMWSSPILLGFDMTKDMSSADLAHDLALV 740 Query: 389 KREVDDFGSEDRLLYGVE--SDEDFVQMLEKESSGGWVCAGAVDSVQNGLQLSISLSGFD 562 K E ++D L G E D + +K+ + G V AV+ N +IS++ +D Sbjct: 741 KNEELIAINQDALGQGAEYIKSADGIDYYQKDLADGDVAIAAVNLSDNSATYTISMADYD 800 Query: 563 GASGSHSYDSNE 598 S SY + + Sbjct: 801 ALDLSESYSARD 812 >UniRef50_Q8G6G7 Cluster: Possible cell surface protein with gram positive anchor domain; n=4; Bacteria|Rep: Possible cell surface protein with gram positive anchor domain - Bifidobacterium longum Length = 2573 Score = 33.5 bits (73), Expect = 4.5 Identities = 30/115 (26%), Positives = 47/115 (40%), Gaps = 2/115 (1%) Frame = +2 Query: 218 DFIRLVNNDGLGNDSCISAWLVHVHNDLNERSGLAWCDWSNDNRGGHDWLSDSTTVGKRE 397 DF+ + N C A +D R G+A ++ NRGGH W ++T K+E Sbjct: 1287 DFVPTIRNSSTDAAVCGGAVRAQAASDTTTRRGMAG-GYAGRNRGGHIW-GNNTAAWKQE 1344 Query: 398 VDD--FGSEDRLLYGVESDEDFVQMLEKESSGGWVCAGAVDSVQNGLQLSISLSG 556 D + R+ Y + E +GG+ G +D+ S+SL G Sbjct: 1345 NTDGKYNGPQRVAYAAR----IRSVYGAEIAGGY--TGFMDAADTAEGGSLSLLG 1393 >UniRef50_Q5KQY6 Cluster: Galactoside O-acetyltransferase; n=3; Klebsiella pneumoniae|Rep: Galactoside O-acetyltransferase - Klebsiella pneumoniae Length = 170 Score = 33.1 bits (72), Expect = 5.9 Identities = 18/39 (46%), Positives = 23/39 (58%) Frame = +2 Query: 182 FSLFGDNNGVGFDFIRLVNNDGLGNDSCISAWLVHVHND 298 F GDN +G DFI VN +GNDS IS+ + + ND Sbjct: 58 FVKMGDNVSIGADFISQVNLT-IGNDSLISSRVSFIGND 95 >UniRef50_A5K5G4 Cluster: Putative uncharacterized protein; n=1; Plasmodium vivax|Rep: Putative uncharacterized protein - Plasmodium vivax Length = 1044 Score = 32.7 bits (71), Expect = 7.8 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = +2 Query: 386 GKREVDDFGSEDRLLYGVESDEDFVQMLEKESSGG 490 G+ E+ D S D +L G+ESDED + +++ SSGG Sbjct: 112 GEEEMSDM-STDEMLSGMESDEDVSEEVKQFSSGG 145 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 484,909,783 Number of Sequences: 1657284 Number of extensions: 8713587 Number of successful extensions: 23676 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 22947 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23654 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 48760335122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -