BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10g14f (637 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. 26 0.87 Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. 26 0.87 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 23 8.1 >Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 26.2 bits (55), Expect = 0.87 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = +1 Query: 463 PEFNDVPLYIYGQSYGGKMAIDMGLRMHEAEKAGTIRSNLKGIAMGNAWI 612 P F+ P Y GQ G ID+ ++ R N G + + W+ Sbjct: 34 PSFSPRPRYAVGQRIVGGFEIDVSDAPYQVSLQYNKRHNCGGSVLSSKWV 83 >Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 26.2 bits (55), Expect = 0.87 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = +1 Query: 463 PEFNDVPLYIYGQSYGGKMAIDMGLRMHEAEKAGTIRSNLKGIAMGNAWI 612 P F+ P Y GQ G ID+ ++ R N G + + W+ Sbjct: 34 PSFSPRPRYAVGQRIVGGFEIDVSDAPYQVSLQYNKRHNCGGSVLSSKWV 83 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 23.0 bits (47), Expect = 8.1 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 Query: 213 EWTFSIFLYWSCCV 172 +W IFLYW C+ Sbjct: 345 DWVRVIFLYWLPCI 358 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 665,673 Number of Sequences: 2352 Number of extensions: 12698 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -