BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10g10f (543 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC543.09 |||mitochondrial m-AAA protease|Schizosaccharomyces p... 25 7.2 SPAC12B10.01c ||SPAC31F12.02c, SPAC637.15c|ubiquitin-protein lig... 25 7.2 SPCC550.07 |||acetamidase |Schizosaccharomyces pombe|chr 3|||Manual 25 7.2 SPAC1486.05 |nup189||nucleoporin Nup189|Schizosaccharomyces pomb... 25 9.5 >SPBC543.09 |||mitochondrial m-AAA protease|Schizosaccharomyces pombe|chr 2|||Manual Length = 773 Score = 25.0 bits (52), Expect = 7.2 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 276 VDVHDELHKRRGTGGNSRSNDNR 208 +D D + K RG GG SND R Sbjct: 394 IDEIDAIGKARGRGGQFGSNDER 416 >SPAC12B10.01c ||SPAC31F12.02c, SPAC637.15c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1647 Score = 25.0 bits (52), Expect = 7.2 Identities = 15/61 (24%), Positives = 24/61 (39%) Frame = -1 Query: 363 DNGALFSLFGDNNGVGLDFSGSIRNTSGNVDVHDELHKRRGTGGNSRSNDNRSGLHGSSH 184 + G FS+ + + SGS RN+SG+ T S D+ + H H Sbjct: 1023 ETGRRFSILREAGSLRESMSGSSRNSSGDYTDSMSQDAPNHTTEPSERRDSSTSSHFEEH 1082 Query: 183 Y 181 + Sbjct: 1083 F 1083 >SPCC550.07 |||acetamidase |Schizosaccharomyces pombe|chr 3|||Manual Length = 533 Score = 25.0 bits (52), Expect = 7.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 357 GALFSLFGDNNGVGLDFSGSIRNTSGN 277 GAL + G+G D GSIR+ + N Sbjct: 212 GALLGIKASVLGIGSDIGGSIRSPAAN 238 >SPAC1486.05 |nup189||nucleoporin Nup189|Schizosaccharomyces pombe|chr 1|||Manual Length = 1778 Score = 24.6 bits (51), Expect = 9.5 Identities = 18/61 (29%), Positives = 25/61 (40%), Gaps = 4/61 (6%) Frame = -1 Query: 339 FGDNNGVGLDFSGSIRNTSGNVDVHDELHKRRGTGGNSR----SNDNRSGLHGSSHYTTV 172 FG NN GS NT GN + G G N+ ++ GL G+ + TT Sbjct: 17 FGQNNQQTGGLFGSNSNTPGNTLFGSQNTSTTGFGQNTTQPLFGSNTNGGLFGNRNNTTT 76 Query: 171 S 169 + Sbjct: 77 T 77 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,267,012 Number of Sequences: 5004 Number of extensions: 15590 Number of successful extensions: 37 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 223909422 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -