BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10g06r (732 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 23 3.4 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 3.4 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +2 Query: 38 VSLKMLKHLYFTKLL 82 + LK L+HL+F KL+ Sbjct: 374 IGLKCLEHLFFFKLI 388 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 22.6 bits (46), Expect = 3.4 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = +2 Query: 218 VFSFILQYVNLIQFQYIKISSLFIYYI*LQNHRTNTVSNFVKVLLQFKE*TSKA 379 +F FI+ LIQF I + + YY + +T+ F LL+ E KA Sbjct: 533 IFGFIIIIGCLIQFNTIVFAFCYCYYS-ISIRPISTLGWFFWSLLRIYELARKA 585 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,895 Number of Sequences: 336 Number of extensions: 4029 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -