BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10g06r (732 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18906| Best HMM Match : LSM (HMM E-Value=3.2e-15) 166 2e-41 SB_26035| Best HMM Match : LSM (HMM E-Value=6.1e-13) 40 0.002 SB_17758| Best HMM Match : Transformer (HMM E-Value=0.35) 34 0.10 SB_45736| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_51082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_10164| Best HMM Match : Keratin_B2 (HMM E-Value=3.4) 28 9.0 >SB_18906| Best HMM Match : LSM (HMM E-Value=3.2e-15) Length = 443 Score = 166 bits (403), Expect = 2e-41 Identities = 80/98 (81%), Positives = 88/98 (89%), Gaps = 1/98 (1%) Frame = -2 Query: 731 EEEEFSTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPR 552 E+EEF+TGPLSVLTQSVKNNTQVLINCRNN+KLL RVKAFDRHCNMVLENVKEMWTE P+ Sbjct: 10 EQEEFNTGPLSVLTQSVKNNTQVLINCRNNRKLLARVKAFDRHCNMVLENVKEMWTETPK 69 Query: 551 T-XXXXXXKAVNKDKFISKMFLRGDSVILVLRNPLATA 441 + K VNKD++I+KMFLRGDSVILVLRNPLATA Sbjct: 70 SGKGKKKAKPVNKDRYIAKMFLRGDSVILVLRNPLATA 107 >SB_26035| Best HMM Match : LSM (HMM E-Value=6.1e-13) Length = 75 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/50 (36%), Positives = 34/50 (68%) Frame = -2 Query: 707 PLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEV 558 PL ++ S+ + ++ + RN+++L GR+ A+D+H NM+L +V+E T V Sbjct: 16 PLDLIRLSL--DERIYVKMRNDRELRGRLHAYDQHLNMILSDVEETITTV 63 >SB_17758| Best HMM Match : Transformer (HMM E-Value=0.35) Length = 974 Score = 34.3 bits (75), Expect = 0.10 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Frame = -2 Query: 716 STGPLSVLTQSVKNNTQVLINCRNNKKLL----GRVKAFDRHCNMVLENVKEMWT 564 S GP+S+L + V+ ++ + R K L G + AFD+H N+ L +V E++T Sbjct: 3 SVGPMSILYRCVEERLKLRVWTRRYKGLRSVLSGYLIAFDKHMNLALMDVDEVYT 57 >SB_45736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 353 Score = 34.3 bits (75), Expect = 0.10 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Frame = -2 Query: 716 STGPLSVLTQSVKNNTQVLINCRNNKKLL----GRVKAFDRHCNMVLENVKEMWT 564 S GP+S+L + V+ ++ + R K L G + AFD+H N+ L +V E++T Sbjct: 148 SVGPMSILYRCVEERLKLRVWTRRYKGLRSVLSGYLIAFDKHMNLALMDVDEVYT 202 >SB_51082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1529 Score = 29.1 bits (62), Expect = 3.9 Identities = 18/59 (30%), Positives = 30/59 (50%) Frame = +3 Query: 480 ITAEEHFGDEFVLVYSFALLSFASSRYLSPHFLNILQYHVTMPVESLHSTQEFLIVTAI 656 I+ EE+FG ++VY F +SS Y P QY T+ ++ ST +++T + Sbjct: 1301 ISREEYFGGYGLVVYDFTPAGNSSSGYFQP------QYKGTVSLDLNFSTAPTVVLTVV 1353 >SB_10164| Best HMM Match : Keratin_B2 (HMM E-Value=3.4) Length = 428 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 43 FKNVKASIFYKIVSYYLHQ 99 FK KASI Y+IV Y++H+ Sbjct: 213 FKVAKASIAYRIVLYFIHR 231 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,017,966 Number of Sequences: 59808 Number of extensions: 420619 Number of successful extensions: 903 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 902 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -