BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10g06f (619 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62840.1 68416.m07060 small nuclear ribonucleoprotein D2, put... 151 4e-37 At2g47640.3 68415.m05946 small nuclear ribonucleoprotein D2, put... 151 4e-37 At2g47640.2 68415.m05945 small nuclear ribonucleoprotein D2, put... 151 4e-37 At2g47640.1 68415.m05944 small nuclear ribonucleoprotein D2, put... 151 4e-37 At1g76860.1 68414.m08944 small nuclear ribonucleoprotein, putati... 52 4e-07 At1g21190.1 68414.m02649 small nuclear ribonucleoprotein, putati... 49 2e-06 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 37 0.012 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 36 0.028 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 36 0.028 At5g48870.1 68418.m06045 small nuclear ribonucleoprotein, putati... 31 0.46 At3g14080.2 68416.m01780 small nuclear ribonucleoprotein, putati... 30 1.1 At3g14080.1 68416.m01779 small nuclear ribonucleoprotein, putati... 30 1.1 At1g19120.1 68414.m02378 small nuclear ribonucleoprotein, putati... 30 1.1 At4g30330.1 68417.m04311 small nuclear ribonucleoprotein E, puta... 27 7.5 At2g18740.1 68415.m02182 small nuclear ribonucleoprotein E, puta... 27 7.5 >At3g62840.1 68416.m07060 small nuclear ribonucleoprotein D2, putative / snRNP core protein D2, putative / Sm protein D2, putative similar to small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) [Mus musculus] SWISS-PROT:P43330 Length = 108 Score = 151 bits (366), Expect = 4e-37 Identities = 71/90 (78%), Positives = 79/90 (87%), Gaps = 1/90 (1%) Frame = +3 Query: 171 FSTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPRT-XX 347 F+TGPLSVL SVKNNTQVLINCRNN+KLLGRV+AFDRHCNMVLENV+EMWTEVP+T Sbjct: 18 FNTGPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKG 77 Query: 348 XXXXXAVNKDKFISKMFLRGDSVILVLRNP 437 VN+D+FISKMFLRGDSVI+VLRNP Sbjct: 78 KKKALPVNRDRFISKMFLRGDSVIIVLRNP 107 >At2g47640.3 68415.m05946 small nuclear ribonucleoprotein D2, putative / snRNP core protein D2, putative / Sm protein D2, putative similar to small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) [Mus musculus] SWISS-PROT:P43330 Length = 108 Score = 151 bits (366), Expect = 4e-37 Identities = 71/90 (78%), Positives = 79/90 (87%), Gaps = 1/90 (1%) Frame = +3 Query: 171 FSTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPRT-XX 347 F+TGPLSVL SVKNNTQVLINCRNN+KLLGRV+AFDRHCNMVLENV+EMWTEVP+T Sbjct: 18 FNTGPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKG 77 Query: 348 XXXXXAVNKDKFISKMFLRGDSVILVLRNP 437 VN+D+FISKMFLRGDSVI+VLRNP Sbjct: 78 KKKALPVNRDRFISKMFLRGDSVIIVLRNP 107 >At2g47640.2 68415.m05945 small nuclear ribonucleoprotein D2, putative / snRNP core protein D2, putative / Sm protein D2, putative similar to small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) [Mus musculus] SWISS-PROT:P43330 Length = 108 Score = 151 bits (366), Expect = 4e-37 Identities = 71/90 (78%), Positives = 79/90 (87%), Gaps = 1/90 (1%) Frame = +3 Query: 171 FSTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPRT-XX 347 F+TGPLSVL SVKNNTQVLINCRNN+KLLGRV+AFDRHCNMVLENV+EMWTEVP+T Sbjct: 18 FNTGPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKG 77 Query: 348 XXXXXAVNKDKFISKMFLRGDSVILVLRNP 437 VN+D+FISKMFLRGDSVI+VLRNP Sbjct: 78 KKKALPVNRDRFISKMFLRGDSVIIVLRNP 107 >At2g47640.1 68415.m05944 small nuclear ribonucleoprotein D2, putative / snRNP core protein D2, putative / Sm protein D2, putative similar to small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) [Mus musculus] SWISS-PROT:P43330 Length = 109 Score = 151 bits (366), Expect = 4e-37 Identities = 71/90 (78%), Positives = 79/90 (87%), Gaps = 1/90 (1%) Frame = +3 Query: 171 FSTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPRT-XX 347 F+TGPLSVL SVKNNTQVLINCRNN+KLLGRV+AFDRHCNMVLENV+EMWTEVP+T Sbjct: 19 FNTGPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKG 78 Query: 348 XXXXXAVNKDKFISKMFLRGDSVILVLRNP 437 VN+D+FISKMFLRGDSVI+VLRNP Sbjct: 79 KKKALPVNRDRFISKMFLRGDSVIIVLRNP 108 >At1g76860.1 68414.m08944 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to SWISS-PROT:Q9Y4Z1 U6 snRNA-associated Sm-like protein LSm3 (MDS017) [Mouse] Length = 98 Score = 51.6 bits (118), Expect = 4e-07 Identities = 31/90 (34%), Positives = 51/90 (56%) Frame = +3 Query: 183 PLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPRTXXXXXXX 362 PL ++ S+ + ++ + R++++L G++ AFD+H NM+L +V+E T V Sbjct: 12 PLDLIRLSL--DERIYVKLRSDRELRGKLHAFDQHLNMILGDVEETITTVEIDDETYEEI 69 Query: 363 AVNKDKFISKMFLRGDSVILVLRNPLATAA 452 + I +F+RGD VILV PL TAA Sbjct: 70 VRTTKRTIEFLFVRGDGVILV-SPPLRTAA 98 >At1g21190.1 68414.m02649 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to SWISS-PROT:Q9Y4Z1 U6 snRNA-associated Sm-like protein LSm3 (MDS017) [Mouse] Length = 97 Score = 49.2 bits (112), Expect = 2e-06 Identities = 27/88 (30%), Positives = 50/88 (56%) Frame = +3 Query: 183 PLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPRTXXXXXXX 362 PL ++ S++ ++ + R++++L G++ AFD+H NM+L +V+E+ T + Sbjct: 12 PLDLIRLSIEE--RIYVKLRSDRELRGKLHAFDQHLNMILGDVEEVITTIEIDDETYEEI 69 Query: 363 AVNKDKFISKMFLRGDSVILVLRNPLAT 446 + + +F+RGD VILV PL T Sbjct: 70 VRTTKRTVPFLFVRGDGVILV-SPPLRT 96 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 36.7 bits (81), Expect = 0.012 Identities = 18/68 (26%), Positives = 35/68 (51%) Frame = +3 Query: 216 NTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPRTXXXXXXXAVNKDKFISKM 395 N ++ + ++ ++L+G+ AFDRH N+VL + +E P + + + + Sbjct: 14 NYRMRVTIQDGRQLIGKFMAFDRHMNLVLGDCEEFRKLPPAKGNKKTNEEREERRTLGLV 73 Query: 396 FLRGDSVI 419 LRG+ VI Sbjct: 74 LLRGEEVI 81 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 35.5 bits (78), Expect = 0.028 Identities = 18/68 (26%), Positives = 37/68 (54%) Frame = +3 Query: 216 NTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPRTXXXXXXXAVNKDKFISKM 395 N ++ + ++ ++L+G+ AFDRH N+VL + +E + ++P + + + Sbjct: 14 NYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEE-FRKLPPAKGKKINEEREDRRTLGLV 72 Query: 396 FLRGDSVI 419 LRG+ VI Sbjct: 73 LLRGEEVI 80 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 35.5 bits (78), Expect = 0.028 Identities = 18/68 (26%), Positives = 37/68 (54%) Frame = +3 Query: 216 NTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPRTXXXXXXXAVNKDKFISKM 395 N ++ + ++ ++L+G+ AFDRH N+VL + +E + ++P + + + Sbjct: 14 NYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEE-FRKLPPAKGKKINEEREDRRTLGLV 72 Query: 396 FLRGDSVI 419 LRG+ VI Sbjct: 73 LLRGEEVI 80 >At5g48870.1 68418.m06045 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm5 [Homo sapiens] SWISS-PROT:Q9Y4Y9 Length = 88 Score = 31.5 bits (68), Expect = 0.46 Identities = 13/33 (39%), Positives = 24/33 (72%) Frame = +3 Query: 219 TQVLINCRNNKKLLGRVKAFDRHCNMVLENVKE 317 +++ + + +K+L+G +K FD + NMVLE+V E Sbjct: 20 SKIWVIMKGDKELVGILKGFDVYVNMVLEDVTE 52 >At3g14080.2 68416.m01780 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm1 (Small nuclear ribonuclear CaSm, Cancer-associated Sm-like) [Homo sapiens] SWISS-PROT:O15116; contains Pfam profile: PF01423 Sm protein Length = 128 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +3 Query: 222 QVLINCRNNKKLLGRVKAFDRHCNMVLENVKE 317 ++L+ R+ +KL+G +++FD+ N VLE E Sbjct: 22 KLLVLLRDGRKLMGTLRSFDQFANAVLEGACE 53 >At3g14080.1 68416.m01779 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm1 (Small nuclear ribonuclear CaSm, Cancer-associated Sm-like) [Homo sapiens] SWISS-PROT:O15116; contains Pfam profile: PF01423 Sm protein Length = 128 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +3 Query: 222 QVLINCRNNKKLLGRVKAFDRHCNMVLENVKE 317 ++L+ R+ +KL+G +++FD+ N VLE E Sbjct: 22 KLLVLLRDGRKLMGTLRSFDQFANAVLEGACE 53 >At1g19120.1 68414.m02378 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm1 (Small nuclear ribonuclear CaSm, Cancer-associated Sm-like) [Homo sapiens] SWISS-PROT:O15116 Length = 128 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +3 Query: 222 QVLINCRNNKKLLGRVKAFDRHCNMVLENVKE 317 ++L+ R+ +KL+G +++FD+ N VLE E Sbjct: 22 KLLVLLRDGRKLMGLLRSFDQFANAVLEEAYE 53 >At4g30330.1 68417.m04311 small nuclear ribonucleoprotein E, putative / snRNP-E, putative / Sm protein E, putative similar to SWISS-PROT:P08578 small nuclear ribonucleoprotein E (snRNP-E) (Sm protein E, Sm-E, SmE) [Chicken] Length = 88 Score = 27.5 bits (58), Expect = 7.5 Identities = 13/50 (26%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = +3 Query: 177 TGPLSVLTQSVKNNTQVLINCRNNKKLL--GRVKAFDRHCNMVLENVKEM 320 T P++++ + +++ ++ I K L GR+ FD + N+VL+ +E+ Sbjct: 11 TQPINLIFRFLQSKARIQIWLFEQKDLRIEGRITGFDEYMNLVLDEAEEV 60 >At2g18740.1 68415.m02182 small nuclear ribonucleoprotein E, putative / snRNP-E, putative / Sm protein E, putative similar to SWISS-PROT:P08578 small nuclear ribonucleoprotein E (snRNP-E) (Sm protein E, Sm-E, SmE) [Chicken] Length = 88 Score = 27.5 bits (58), Expect = 7.5 Identities = 13/50 (26%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = +3 Query: 177 TGPLSVLTQSVKNNTQVLINCRNNKKLL--GRVKAFDRHCNMVLENVKEM 320 T P++++ + +++ ++ I K L GR+ FD + N+VL+ +E+ Sbjct: 11 TQPINLIFRFLQSKARIQIWLFEQKDLRIEGRITGFDEYMNLVLDEAEEV 60 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,897,374 Number of Sequences: 28952 Number of extensions: 219027 Number of successful extensions: 469 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1246162608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -