BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10g05r (567 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY994091-1|AAX86004.1| 83|Anopheles gambiae hyp6.3 precursor p... 25 1.7 AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 24 3.0 U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 23 5.3 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 23 5.3 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 5.3 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 5.3 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 6.9 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 23 9.2 AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding pr... 23 9.2 AJ973471-1|CAJ01518.1| 122|Anopheles gambiae hypothetical prote... 23 9.2 AJ697731-1|CAG26924.1| 122|Anopheles gambiae putative chemosens... 23 9.2 AJ697730-1|CAG26923.1| 122|Anopheles gambiae putative chemosens... 23 9.2 >AY994091-1|AAX86004.1| 83|Anopheles gambiae hyp6.3 precursor protein. Length = 83 Score = 25.0 bits (52), Expect = 1.7 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = -2 Query: 518 MKFALLFVLTAIVAVSTNEVADPRSTDRANALSIGSITSSDRLLRSFVVSRAATI 354 MKFA FVL A+ AV A P+ ++A A S ++ +++ +AA + Sbjct: 1 MKFAFAFVLIALFAVFAVSQALPQ-PEQAAASSNDGASAITKIVLELTPEQAAAV 54 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 24.2 bits (50), Expect = 3.0 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 4/76 (5%) Frame = +1 Query: 301 LTRLPAG----AVNLTLRTRQLIVAARLTTKLRKSLSLEVILPILKALALSVDLGSATSL 468 +T +P G A LTL TR+ I + R + +V++ + + L Sbjct: 94 VTSIPRGEKLRAAELTL-TREGIAHRSSRAQARTPVLYQVMVYDIVRPGVKGKRAPTFLL 152 Query: 469 VDTATIAVNTNNRANF 516 VDT T+A+N + A+F Sbjct: 153 VDTKTLAINESGTASF 168 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 23.4 bits (48), Expect = 5.3 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +3 Query: 507 SELHLAGNLYWYSESIVS 560 +E HLA +++W+S+ I S Sbjct: 54 AEEHLAASIFWWSKIIFS 71 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 23.4 bits (48), Expect = 5.3 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +3 Query: 507 SELHLAGNLYWYSESIVS 560 +E HLA +++W+S+ I S Sbjct: 126 AEEHLAASIFWWSKIIFS 143 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.4 bits (48), Expect = 5.3 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +3 Query: 15 FTVRKKRQGKLRNKYANY*LKKWGERIFCANKKTKT 122 + RK G N ANY LK+ E CA T Sbjct: 1844 YEARKGFAGAEANNAANYQLKRDSETTLCARNLETT 1879 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.4 bits (48), Expect = 5.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 187 KNALRGAFTN*RFTKVKPTPPPVRRT 264 +NA R A T R + P PPP RT Sbjct: 1062 RNAARRAATQQRQAERLPPPPPSPRT 1087 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.0 bits (47), Expect = 6.9 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 238 PTPPPVRRTLVNCVDPRTRTALTR 309 P+PPP RT D R R A R Sbjct: 1069 PSPPPSPRTAARRADLRLRQARFR 1092 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 22.6 bits (46), Expect = 9.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 214 N*RFTKVKPTPPPVRRTLVNCVDPRTRTALTR 309 N R P PPP R D R R A R Sbjct: 1126 NRRSQPTPPAPPPTPREAARLEDGRRRVARWR 1157 >AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding protein AgamOBP43 protein. Length = 333 Score = 22.6 bits (46), Expect = 9.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 222 SSVCERAAKSIFFYRTNLGTLK 157 + VCERA +S Y + G L+ Sbjct: 130 TDVCERAHRSFLCYHQHYGYLR 151 >AJ973471-1|CAJ01518.1| 122|Anopheles gambiae hypothetical protein protein. Length = 122 Score = 22.6 bits (46), Expect = 9.2 Identities = 9/40 (22%), Positives = 23/40 (57%) Frame = -2 Query: 494 LTAIVAVSTNEVADPRSTDRANALSIGSITSSDRLLRSFV 375 + AI A+ + + TD+ + + + + S+DR+L +++ Sbjct: 6 MVAIFAMVVVLASAQKYTDKFDNIDVDRVLSNDRILNNYL 45 >AJ697731-1|CAG26924.1| 122|Anopheles gambiae putative chemosensory protein CSP2 protein. Length = 122 Score = 22.6 bits (46), Expect = 9.2 Identities = 9/40 (22%), Positives = 23/40 (57%) Frame = -2 Query: 494 LTAIVAVSTNEVADPRSTDRANALSIGSITSSDRLLRSFV 375 + AI A+ + + TD+ + + + + S+DR+L +++ Sbjct: 6 MVAIFAMVVVLASAQKYTDKFDNIDVDRVLSNDRILNNYL 45 >AJ697730-1|CAG26923.1| 122|Anopheles gambiae putative chemosensory protein CSP1 protein. Length = 122 Score = 22.6 bits (46), Expect = 9.2 Identities = 9/40 (22%), Positives = 23/40 (57%) Frame = -2 Query: 494 LTAIVAVSTNEVADPRSTDRANALSIGSITSSDRLLRSFV 375 + AI A+ + + TD+ + + + + S+DR+L +++ Sbjct: 6 MVAIFAMVVVLASAQKYTDKFDNIDVDRVLSNDRILNNYL 45 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 529,110 Number of Sequences: 2352 Number of extensions: 9181 Number of successful extensions: 25 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53404389 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -