BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10g04r (394 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33308| Best HMM Match : Ribosomal_L34e (HMM E-Value=9e-07) 56 8e-09 SB_41650| Best HMM Match : RVT_1 (HMM E-Value=1.6e-06) 30 0.58 SB_19489| Best HMM Match : TP2 (HMM E-Value=0.58) 29 1.8 SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 29 1.8 SB_979| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_36327| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_373| Best HMM Match : Somatomedin_B (HMM E-Value=3.5) 28 3.1 SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) 27 4.1 SB_22814| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.1 SB_50855| Best HMM Match : Ras (HMM E-Value=0) 27 5.4 SB_32196| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_39210| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_800| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_9363| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_14238| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.5 SB_803| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.5 >SB_33308| Best HMM Match : Ribosomal_L34e (HMM E-Value=9e-07) Length = 58 Score = 56.4 bits (130), Expect = 8e-09 Identities = 26/44 (59%), Positives = 31/44 (70%) Frame = -1 Query: 187 RPAERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIV 56 RP + + +KTV R YGG C CVK+RI+RAFLIEEQKIV Sbjct: 2 RPMKLMHISKPQKTVSRAYGGSRCAACVKERIIRAFLIEEQKIV 45 >SB_41650| Best HMM Match : RVT_1 (HMM E-Value=1.6e-06) Length = 299 Score = 30.3 bits (65), Expect = 0.58 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 341 IQATTVVQHKIKSKKNSKDTGWPLGLSV 258 I VQH K+KK + DT +P+G++V Sbjct: 45 ISGEYAVQHSCKNKKETIDTDYPIGMAV 72 >SB_19489| Best HMM Match : TP2 (HMM E-Value=0.58) Length = 429 Score = 28.7 bits (61), Expect = 1.8 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -1 Query: 334 RRLSYNTKSNQRRIVRTPGGRLVYQYVKKP 245 RR++ T SN R++RTP G+ ++ VK P Sbjct: 159 RRITKTTNSNSTRLIRTP-GQSIHIKVKAP 187 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 28.7 bits (61), Expect = 1.8 Identities = 18/60 (30%), Positives = 31/60 (51%) Frame = -3 Query: 380 PAVKKLENGAAAYIQATTVVQHKIKSKKNSKDTGWPLGLSVCKKAQEDPKVWSVQEQTPW 201 P VK+ ++AYI T+ + K+K+K T P V K A E+ K + +++ P+ Sbjct: 494 PVVKR---ASSAYIHFTSDFRAKLKAKSAKSGTPLPKANEVAKLAGEEWKKLNDEQKKPY 550 >SB_979| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 673 Score = 28.3 bits (60), Expect = 2.3 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +2 Query: 98 LLDTFMAEDTTINTFHCFLTVAKTGTFSRSSWLDTTEFALALTTPW 235 L+D + + + + HCF+T+ T T ++ S T F L +PW Sbjct: 542 LIDELVKQSSCPSRAHCFITMTTTQTSTKISIAPTNTFFL---SPW 584 >SB_36327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 409 Score = 27.9 bits (59), Expect = 3.1 Identities = 14/53 (26%), Positives = 27/53 (50%) Frame = -1 Query: 208 LRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVKV 50 ++G++ R + S C R V +VY +C +C + V+ + E ++ KV Sbjct: 201 VKGVRDVRVNKVSERCLRGACVYKVYERCVCTRCTRGACVQG--LREVRVYKV 251 >SB_373| Best HMM Match : Somatomedin_B (HMM E-Value=3.5) Length = 404 Score = 27.9 bits (59), Expect = 3.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -1 Query: 391 FPCHQLSKSLKMVQRLTFRRRLSYNTKSNQRRIVRT 284 FP Q+ + K RL RRL N +RR+++T Sbjct: 160 FPNKQIRRRRKSNLRLALTRRLGKNNPGKKRRVMQT 195 >SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) Length = 857 Score = 27.5 bits (58), Expect = 4.1 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -3 Query: 152 ENSETCLWWCPLP*MCQATHCQSLPH*RTKNCEGPQGTT 36 ++ + LW P+P Q + C+S P T E P TT Sbjct: 223 KHPDLMLWRKPVPKTDQQSECESSPGANTDRLESPARTT 261 >SB_22814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 27.5 bits (58), Expect = 4.1 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 253 LHTDKPSGHPVSLLFFFDLI 312 LHT +P+GHP ++ FD I Sbjct: 5 LHTTEPTGHPCHIVCCFDAI 24 >SB_50855| Best HMM Match : Ras (HMM E-Value=0) Length = 733 Score = 27.1 bits (57), Expect = 5.4 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +2 Query: 89 DNALLDTFMAEDTTINTFHCFLTVAKTGTFSRSSWLDTTEF 211 DN LL + T +N FL + K G + L+ TEF Sbjct: 155 DNGLLFMETSAKTAMNVNDIFLAIGKKGKKKKGKTLNLTEF 195 >SB_32196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1333 Score = 27.1 bits (57), Expect = 5.4 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 Query: 110 MCQATHCQSLPH*RTKNCEGPQGT 39 +CQ HC LP R K+C+ P T Sbjct: 115 VCQDDHCACLPCWRGKSCDQPDLT 138 >SB_39210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 378 Score = 26.6 bits (56), Expect = 7.2 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = -3 Query: 392 FSLSPAVKKLENGAAAYIQATTVVQHK-IKSKKNSKDTGWPLGLSVCKKAQEDPK 231 +S S ++K + N AA + ++ +K I KKN + LG +C+K + + K Sbjct: 210 YSRSISLKDIFNAAAKSSHSESIQWNKYINCKKNKTNLAAFLGEQLCEKGKREQK 264 >SB_800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 26.6 bits (56), Expect = 7.2 Identities = 14/60 (23%), Positives = 25/60 (41%) Frame = -1 Query: 385 CHQLSKSLKMVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKL 206 C L+ + ++ T + +Y K N +V P G Q ++ CG K++L Sbjct: 36 CSALTSTSALIDHTTIKLFGTYEEKGNLFFVVVAPSGSDKIQPARRVASTRSCGNSKTRL 95 >SB_9363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 26.6 bits (56), Expect = 7.2 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 112 YGRGHHH-KHVSLFSYGSKDGNVQQV*LAGYHGVCSCTDHTL 234 YG H K + L YG+ G V+++ L GY HTL Sbjct: 238 YGTSHGLVKEIDLRGYGTSHGPVKEIELRGYGTSYRGPSHTL 279 >SB_14238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 799 Score = 26.2 bits (55), Expect = 9.5 Identities = 17/69 (24%), Positives = 30/69 (43%) Frame = -1 Query: 391 FPCHQLSKSLKMVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKS 212 F CH+ + ++ K R +VRTPG RL + + PK P + + Sbjct: 150 FLCHETDAPFVLKATSKVVGSKEFDQKCVFRPVVRTPGTRLTTKTIITPK--PLTDERQK 207 Query: 211 KLRGIQPAR 185 +L+ + A+ Sbjct: 208 ELKAAEAAK 216 >SB_803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 26.2 bits (55), Expect = 9.5 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = -3 Query: 134 LWWCPLP*M--CQATHCQSLPH 75 LWW L M C+A H SLPH Sbjct: 230 LWWPKLENMHNCEACHGSSLPH 251 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,400,490 Number of Sequences: 59808 Number of extensions: 257580 Number of successful extensions: 768 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 768 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 678472135 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -