BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10f20f (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosylt... 27 0.39 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 27 0.68 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 27 0.68 U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 26 0.90 U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase... 23 6.3 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 23 6.3 U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. 23 8.4 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 8.4 >DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosyltransferase 2 protein. Length = 451 Score = 27.5 bits (58), Expect = 0.39 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 350 LKSRLGPRRTMLLVSPSQSLSHTRMVLIPTSWLVW 454 L+++ G RRT L++ P SL H R I L+W Sbjct: 82 LRTQRGYRRTRLVLPPWSSLVHWRSGNIDQQQLLW 116 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 26.6 bits (56), Expect = 0.68 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -3 Query: 173 PWPFTAPARRPLINIWAPREGKIAN 99 PWP +P P+ N+W+ + ++ N Sbjct: 259 PWPALSPDLNPIENLWSTLKRQLKN 283 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 26.6 bits (56), Expect = 0.68 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 471 ACKAEEELPERCKAFGRVSFTADFICHSRRGY*D 572 AC + E P++C + S++++ + SR GY D Sbjct: 751 ACDCKMECPKQCTCYHDQSWSSNVVDCSRAGYDD 784 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 26.2 bits (55), Expect = 0.90 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -3 Query: 173 PWPFTAPARRPLINIWAPREGKIAN 99 PWP +P P+ N+W+ + + N Sbjct: 187 PWPALSPDLNPIENLWSTLKRHVKN 211 >U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase protein. Length = 250 Score = 23.4 bits (48), Expect = 6.3 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -3 Query: 170 WPFTAPARRPLINIWA 123 WP +P P+ N+WA Sbjct: 178 WPALSPDLNPIENLWA 193 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 612 NDYVLNGVDTSIRDLNNLVESD 547 ND V + +DT++ D N+L E+D Sbjct: 267 NDLVTSIIDTALVDDNSLQETD 288 >U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. Length = 280 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 194 SAFFLRRPWPFTAPARRPLINIWAPREGKI 105 +A FLR +P RPLINI+ +G + Sbjct: 62 AAHFLRNTYPLL----RPLINIFLKTDGSL 87 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.0 bits (47), Expect = 8.4 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -2 Query: 288 QRESSFFHHFTHKGFSLNDFAQDHTEPH 205 Q++ S +H H G S + H PH Sbjct: 166 QQQPSSYHQQQHPGHSQHHHHHHHHHPH 193 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 666,516 Number of Sequences: 2352 Number of extensions: 13695 Number of successful extensions: 22 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -