BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10f18f (557 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g05805.1 68414.m00607 basic helix-loop-helix (bHLH) family pr... 29 2.8 At3g07550.2 68416.m00902 F-box family protein (FBL12) contains s... 27 6.4 At3g07550.1 68416.m00901 F-box family protein (FBL12) contains s... 27 6.4 At2g27060.1 68415.m03251 leucine-rich repeat transmembrane prote... 27 6.4 At1g65440.1 68414.m07424 glycine-rich protein 27 6.4 At4g29440.1 68417.m04203 expressed protein contains Pfam profil... 27 8.5 >At1g05805.1 68414.m00607 basic helix-loop-helix (bHLH) family protein Length = 362 Score = 28.7 bits (61), Expect = 2.8 Identities = 24/85 (28%), Positives = 37/85 (43%) Frame = -2 Query: 322 NNGVGFDFIGLVNNDGLRNDSSISSWLVHVHNDLNERSGLAWCDWSNDNGGGHDWLSDST 143 +N +G F G ++ LR+DS+ V+N + + L +N+N D D + Sbjct: 60 DNFIGNFFTGAADSSSLRSDSTTCG----VNNSSDGQKQLGN---NNNNNSNKDIFLDRS 112 Query: 142 TVGKREIDDFGCENGLGGVGDSHSY 68 G EI N +GG S SY Sbjct: 113 YGGFNEISQQHKSNDIGGGNSSGSY 137 >At3g07550.2 68416.m00902 F-box family protein (FBL12) contains similarity to F-box protein FBL6 GI:6456737 from [Homo sapiens] Length = 395 Score = 27.5 bits (58), Expect = 6.4 Identities = 8/26 (30%), Positives = 20/26 (76%) Frame = +3 Query: 480 NLFKCNVNNIGITSIVRIKLTQKYID 557 +L++CN+++IG+ ++ R L+ K ++ Sbjct: 149 SLYRCNISDIGLETLARASLSLKCVN 174 >At3g07550.1 68416.m00901 F-box family protein (FBL12) contains similarity to F-box protein FBL6 GI:6456737 from [Homo sapiens] Length = 395 Score = 27.5 bits (58), Expect = 6.4 Identities = 8/26 (30%), Positives = 20/26 (76%) Frame = +3 Query: 480 NLFKCNVNNIGITSIVRIKLTQKYID 557 +L++CN+++IG+ ++ R L+ K ++ Sbjct: 149 SLYRCNISDIGLETLARASLSLKCVN 174 >At2g27060.1 68415.m03251 leucine-rich repeat transmembrane protein kinase, putative Length = 1007 Score = 27.5 bits (58), Expect = 6.4 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -2 Query: 187 SNDNGGGHDWLSDSTTVGKREIDDFG-CENGLGGV 86 SN+N G L D++TVG + + G N LGGV Sbjct: 425 SNNNFSGSLPLQDASTVGNLSLTNIGLSHNSLGGV 459 >At1g65440.1 68414.m07424 glycine-rich protein Length = 1647 Score = 27.5 bits (58), Expect = 6.4 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -2 Query: 190 WSNDNGGGHD--WLSDSTTVGKREIDDFGCENGLGGVGDSHSYDS 62 W + +GGG W +DS GK+ +D G +G GG G +S Sbjct: 1563 WGSGSGGGGSGGWGNDSG--GKKSSEDGGFGSGSGGGGSDWGNES 1605 >At4g29440.1 68417.m04203 expressed protein contains Pfam profile: PF03398 eukaryotic protein of unknown function, DUF292 Length = 1090 Score = 27.1 bits (57), Expect = 8.5 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -2 Query: 316 GVGFDFIGLVNNDGLRNDSSISSWLVHVHNDLNERS 209 G+GF +G + + ISSW + H DL + S Sbjct: 532 GLGFSLLGSSSKTSDHMPTEISSWSLEGHKDLGKLS 567 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,649,370 Number of Sequences: 28952 Number of extensions: 178682 Number of successful extensions: 538 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 537 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1062855648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -