BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10f14r (677 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q59SS0 Cluster: Putative uncharacterized protein; n=1; ... 36 0.91 UniRef50_A4JYI9 Cluster: CDNA, clone cssl:d0139; n=5; Danio reri... 33 6.4 >UniRef50_Q59SS0 Cluster: Putative uncharacterized protein; n=1; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 108 Score = 35.9 bits (79), Expect = 0.91 Identities = 22/63 (34%), Positives = 35/63 (55%) Frame = -3 Query: 246 GLFCMYFNPVSLKISQCIE*LFAIIHNILLVST*VTMD*ILYFIIDSVSSHWSKFEQYSY 67 GLF +YF P+ + + QCI L+ I++N+L VST I+ I ++ SH F + Sbjct: 47 GLFVVYFPPI-IAVHQCIITLY-ILYNVLYVSTCPDQPRIVSLFIFALLSHAFAFRVVDF 104 Query: 66 DFV 58 F+ Sbjct: 105 IFI 107 >UniRef50_A4JYI9 Cluster: CDNA, clone cssl:d0139; n=5; Danio rerio|Rep: CDNA, clone cssl:d0139 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 315 Score = 33.1 bits (72), Expect = 6.4 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +2 Query: 74 YCSNFDQCEDTLSIIKYKIQSIVTYVLTNNMLCIIANNYSMHCDIFN 214 Y + QCE L + YK V+ + T N I N Y + CD++N Sbjct: 89 YINYGKQCEVALPVTVYKTPDSVS-ISTVNQTMIEGNQYELQCDVYN 134 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 556,000,825 Number of Sequences: 1657284 Number of extensions: 9716988 Number of successful extensions: 18100 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18098 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52479343733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -