BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10f14r (677 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16860| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_14859| Best HMM Match : SEA (HMM E-Value=0.01) 28 8.0 >SB_16860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 691 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = -3 Query: 360 NMTKFNLCKLESFIE*NLDCENPSGFIYRISKTDLSKVGLFC 235 ++ + NLC E F+ +L+C G + K D+S C Sbjct: 394 SIEELNLCGCECFVSSDLECYFEEGLFSNLEKLDISSCPDIC 435 >SB_14859| Best HMM Match : SEA (HMM E-Value=0.01) Length = 1776 Score = 27.9 bits (59), Expect = 8.0 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = +2 Query: 80 SNFDQCEDTLSIIKYKIQSIVTYVLTNNMLCIIANNYSMHCDIFNDTGLKYIQNN 244 +N ++C+DT + KYK + TNN NN + D ND KY NN Sbjct: 763 NNNNECKDTNNDNKYKYNNNNECKDTNNGNKYKYNNNNECKDTNNDNKYKYNNNN 817 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,166,023 Number of Sequences: 59808 Number of extensions: 292720 Number of successful extensions: 502 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -