BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10f12r (567 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory pro... 27 0.15 AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical pro... 27 0.15 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 1.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.7 >DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory protein 12 protein. Length = 127 Score = 26.6 bits (56), Expect = 0.15 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -2 Query: 497 VLTAIVAVSTNEVADPRSTDRANALSIGSITSSDRLLRSFV 375 VL VAV + A + T + + + + I SDRLL+++V Sbjct: 5 VLVLFVAVLSVVFAADKYTTKYDNIDLNQILKSDRLLKNYV 45 >AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical protein protein. Length = 127 Score = 26.6 bits (56), Expect = 0.15 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -2 Query: 497 VLTAIVAVSTNEVADPRSTDRANALSIGSITSSDRLLRSFV 375 VL VAV + A + T + + + + I SDRLL+++V Sbjct: 5 VLVLFVAVVSVVFAADKYTTKYDNIDLNQILKSDRLLKNYV 45 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.0 bits (47), Expect = 1.8 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = -1 Query: 150 FWTFTCKYTKFLFFRLHKKFVLPIFFN**FAYLFRSFLVF 31 ++ F LF FV+P+FF Y + +F++F Sbjct: 117 YYAFIIFTVHLLFLLCIYYFVVPLFFLLCIYYFYCAFIIF 156 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 9.7 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 244 PPPVRRTLANCVDPRT 291 PPP T + VDP++ Sbjct: 1806 PPPQHSTTQSLVDPKS 1821 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,480 Number of Sequences: 336 Number of extensions: 2186 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13995094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -