BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10f11f (536 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42110| Best HMM Match : Pox_A32 (HMM E-Value=0.034) 30 1.0 SB_38871| Best HMM Match : DUF590 (HMM E-Value=5.5e-21) 29 1.8 SB_31270| Best HMM Match : rve (HMM E-Value=0.0043) 29 2.4 SB_41802| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_48572| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_27857| Best HMM Match : Cadherin (HMM E-Value=0) 27 9.7 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 27 9.7 SB_54480| Best HMM Match : Folate_rec (HMM E-Value=1.5) 27 9.7 SB_33462| Best HMM Match : DUF400 (HMM E-Value=6.7) 27 9.7 >SB_42110| Best HMM Match : Pox_A32 (HMM E-Value=0.034) Length = 720 Score = 30.3 bits (65), Expect = 1.0 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 5/65 (7%) Frame = -3 Query: 261 STGRRRVPHVDSLRAGCRSTSHNEAP*QSIIWSNTAD--CQTVCSASRAGVS---HFISR 97 ST RR+ V LR+ CR + A ++ TAD ++ SASR+ +S H +SR Sbjct: 575 STERRKRRFVSPLRSSCRGRRRDSAH-KATACGRTADQGARSGDSASRSRISAVIHEVSR 633 Query: 96 HGDDR 82 H D R Sbjct: 634 HLDTR 638 >SB_38871| Best HMM Match : DUF590 (HMM E-Value=5.5e-21) Length = 319 Score = 29.5 bits (63), Expect = 1.8 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +3 Query: 246 GACR*TRQGRPSPGSRGVPVRDRPPC 323 GAC QGR PG RGV +RD C Sbjct: 104 GACISGIQGRVHPGYRGVHIRDTGAC 129 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 246 GACR*TRQGRPSPGSRGVPVRDRPPCRGR 332 GAC Q R PG RGV +RD C R Sbjct: 127 GACTSGIQERAHPGYRGVHIRDTGACTYR 155 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +3 Query: 246 GACR*TRQGRPSPGSRGVPVRDRPPC 323 GAC QGR G RGV +RD C Sbjct: 81 GACTSGIQGRAHTGYRGVHIRDTGAC 106 >SB_31270| Best HMM Match : rve (HMM E-Value=0.0043) Length = 479 Score = 29.1 bits (62), Expect = 2.4 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -1 Query: 287 SRARTALTRLPAGAVYLTLTACELAVAARVTTKLRNSLSFGAILPIA 147 S R LTRL ++ L +T CE + R N ++ G +LPIA Sbjct: 260 SNIRGVLTRLQVHSLCLQITKCEFVL--REVEYKGNKITQGGVLPIA 304 >SB_41802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 28.7 bits (61), Expect = 3.2 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -1 Query: 305 NWDTPTSRARTALTRLPAGAVYLTLTACELAVAARVTT 192 +WD S A L P G+ + L AC+L R TT Sbjct: 35 SWDALVSLAEDDLKGCPRGSSRVDLQACKLGTGRRFTT 72 >SB_48572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 286 Score = 27.1 bits (57), Expect = 9.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 186 ELRCDSCCDSQLAGCQREVHGA 251 E+ CDSC DSQ + EV+G+ Sbjct: 122 EMICDSCMDSQQVITKEEVNGS 143 >SB_27857| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2418 Score = 27.1 bits (57), Expect = 9.7 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 Query: 333 PAPDKADGRELGHPYFPGS 277 P PD AD +E PYFP S Sbjct: 353 PLPDSADPKENTKPYFPQS 371 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 27.1 bits (57), Expect = 9.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 348 RHSPVQKLSTKRISLQCTDL 407 RH+PV K++ R+S C DL Sbjct: 191 RHNPVLKIAGPRVSADCRDL 210 >SB_54480| Best HMM Match : Folate_rec (HMM E-Value=1.5) Length = 635 Score = 27.1 bits (57), Expect = 9.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 201 SCCDSQLAGCQREVHGACR*TRQGRPSPGSRGV 299 SC +L GC R+ G+ R +PS SR V Sbjct: 435 SCATGRLPGCTRKPSGSSRRVFSRKPSGSSRRV 467 >SB_33462| Best HMM Match : DUF400 (HMM E-Value=6.7) Length = 212 Score = 27.1 bits (57), Expect = 9.7 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -2 Query: 346 KLNRPRPRQGGRSXXXXXXXXXXXXXXRVYRQAPC 242 KL R RPR+ G+S VYR+ PC Sbjct: 31 KLRRRRPRRPGQSATEKEKPAPVLGPSDVYRENPC 65 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,621,293 Number of Sequences: 59808 Number of extensions: 282442 Number of successful extensions: 751 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1215643300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -