BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10f11f (536 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 6.5 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.0 bits (47), Expect = 6.5 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 306 ELGHPYFPGSDGPDASTGRRRVP 238 ++G P FPG G +TG +P Sbjct: 377 DMGVPGFPGVKGDKGTTGLPGIP 399 Score = 22.6 bits (46), Expect = 8.6 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -3 Query: 333 PAPDKADGRELGHPYFPGSDGPDASTGRRRVP 238 P +K D + G PG+DG G+R +P Sbjct: 592 PQGEKGDRGDSGLMGRPGNDGLPGPQGQRGLP 623 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 490,001 Number of Sequences: 2352 Number of extensions: 9795 Number of successful extensions: 26 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49897362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -