BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10f10r (659 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 27 0.69 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 2.1 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 24 3.7 AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 23 6.5 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 23 8.5 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 26.6 bits (56), Expect = 0.69 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 356 CFPLDRYNTHKLRSHISLFFTLHSSF 433 CFP R H L H+ F + H+S+ Sbjct: 33 CFPYTRQKPHLLYGHMEQFQSKHASY 58 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.0 bits (52), Expect = 2.1 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +3 Query: 111 LAIFIKMFIISL---PKGLKCYHTFVPRTLKAMRDETV 215 L I ++ F++SL P CY T +P T+ + TV Sbjct: 932 LNIHVRFFMLSLENKPHVFDCYTTVIPHTVLTQYNYTV 969 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 24.2 bits (50), Expect = 3.7 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 436 TNTHADLSWKVLNHNSTPTTLPFLVWRY 519 TNT + S VLNH++T T + VW Y Sbjct: 231 TNTKSS-SDPVLNHDTTNTGIAEKVWLY 257 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 580 PLEHVLHYISEVSW 621 P+EHVLH E+ W Sbjct: 161 PVEHVLHLEEELYW 174 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 23.0 bits (47), Expect = 8.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 400 YFIVFHITFILHTNTHADL 456 + IV + ++H THADL Sbjct: 717 FHIVIGMNLVVHIGTHADL 735 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 705,384 Number of Sequences: 2352 Number of extensions: 14889 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -