BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10f08r (756 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 28 0.11 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 24 1.3 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 24 1.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 2.3 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 2.3 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 5.4 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 5.4 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 5.4 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 22 5.4 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 5.4 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 22 5.4 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 7.1 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 9.4 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 9.4 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 21 9.4 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 21 9.4 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 21 9.4 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 21 9.4 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 27.9 bits (59), Expect = 0.11 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 523 PTLGTPLTAVLYRPLARPRQST 588 P +GTP T ++Y+P P Q++ Sbjct: 847 PVIGTPSTGMMYKPFLIPEQTS 868 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 24.2 bits (50), Expect = 1.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 345 TTPPGPSRIQTGNPVGSATSLSSS 416 TTP PSR Q+ + SA ++S+S Sbjct: 530 TTPVLPSRFQSHPSIDSANTISNS 553 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 23.8 bits (49), Expect = 1.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 755 HQVITNGNVNSIRNSNYNGNLPLFVIVHGWNSNGN 651 + IT GN N+ ++N N N +G N NGN Sbjct: 225 NSTITAGNANTNASNNNNNNNNNNNNNNGANDNGN 259 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 740 NGNVNSIRNSNYNGNL 693 NGN N N+N NG++ Sbjct: 257 NGNGNGASNNNNNGDM 272 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 573 TTPVHNNNVAVGDGQQGGAD 632 + P +N + GDG++GGA+ Sbjct: 1052 SNPSYNFSSVSGDGEEGGAE 1071 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 573 TTPVHNNNVAVGDGQQGGAD 632 + P +N + GDG++GGA+ Sbjct: 1048 SNPSYNFSSVSGDGEEGGAE 1067 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 740 NGNVNSIRNSNYNGN 696 N N N+ N+NYN N Sbjct: 98 NNNYNNNYNNNYNNN 112 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 740 NGNVNSIRNSNYNGN 696 N N N+ N+NYN N Sbjct: 98 NNNYNNNYNNNYNNN 112 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 181 RL*EQVLTLQPGWGFLPPLG*KSP 252 R+ + LQPG F PLG + P Sbjct: 458 RMDRDAVYLQPGMSFGEPLGLRRP 481 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 22.2 bits (45), Expect = 5.4 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 5/93 (5%) Frame = -2 Query: 698 NLPLFVIVHGWNSNGNSAVNTMIRPALLAVSDCNVIVVDWRGLANGLYNTAVNGVP-SVG 522 +LP+ +HG S + + L SD + +++R G +T VP ++G Sbjct: 121 SLPVIFWIHGGAFQFGSGIPMGAK--YLMDSDVIFVTINYRLGILGFLSTEDEVVPGNMG 178 Query: 521 -QFLGNFLVWLINN---GGGNWGRVHLIGFSLG 435 + L W+ N GGN R+ LIG S G Sbjct: 179 LKDQSMALRWVSENIEWFGGNPKRITLIGLSAG 211 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -2 Query: 740 NGNVNSIRNSNYNGNLPLF 684 N N N+ N+NYN L+ Sbjct: 335 NNNYNNYNNNNYNNYKKLY 353 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 22.2 bits (45), Expect = 5.4 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 5/93 (5%) Frame = -2 Query: 698 NLPLFVIVHGWNSNGNSAVNTMIRPALLAVSDCNVIVVDWRGLANGLYNTAVNGVP-SVG 522 +LP+ +HG S + + L SD + +++R G +T VP ++G Sbjct: 121 SLPVIFWIHGGAFQFGSGIPMGAK--YLMDSDVIFVTINYRLGILGFLSTEDEVVPGNMG 178 Query: 521 -QFLGNFLVWLINN---GGGNWGRVHLIGFSLG 435 + L W+ N GGN R+ LIG S G Sbjct: 179 LKDQSMALRWVSENIEWFGGNPKRITLIGLSAG 211 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 740 NGNVNSIRNSNYNGN 696 N N N+ N+NYN N Sbjct: 332 NYNNNNYNNNNYNNN 346 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -3 Query: 421 VTLDDRLVADPTGLPVW 371 +TLDD++ P P+W Sbjct: 643 MTLDDKVFGFPLDRPMW 659 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -3 Query: 421 VTLDDRLVADPTGLPVW 371 +TLDD++ P P+W Sbjct: 643 MTLDDKVFGFPLDRPMW 659 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 734 NVNSIRNSNYNGN 696 N N+ N+NYN N Sbjct: 93 NYNNYNNNNYNNN 105 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 734 NVNSIRNSNYNGN 696 N N+ N+NYN N Sbjct: 93 NYNNYNNNNYNNN 105 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 734 NVNSIRNSNYNGN 696 N N+ N+NYN N Sbjct: 93 NYNNYNNNNYNNN 105 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 734 NVNSIRNSNYNGN 696 N N+ N+NYN N Sbjct: 93 NYNNYNNNNYNNN 105 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 245,527 Number of Sequences: 438 Number of extensions: 6448 Number of successful extensions: 29 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -