BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10f05r (726 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g67240.1 68418.m08475 exonuclease family protein contains exo... 29 4.1 At4g01580.1 68417.m00206 transcriptional factor B3 family protei... 27 9.6 >At5g67240.1 68418.m08475 exonuclease family protein contains exonuclease domain, Pfam:PF00929 Length = 745 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -1 Query: 117 VSSTGCHTDYPAGFIRPGHYHDWYLEVTG 31 V T H DYP + P + DWY+ G Sbjct: 105 VRLTITHDDYPGNYTFPSYAEDWYVTELG 133 >At4g01580.1 68417.m00206 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 190 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = -1 Query: 114 SSTGCHTDYPAGFIRPGHYHDWYLEVTGIDFDLETRN 4 +++ C T+YP + D +E+TG +FD E ++ Sbjct: 120 NASACETNYPLDAVHIIDSDDDVIEITGKEFDTEHKS 156 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,816,228 Number of Sequences: 28952 Number of extensions: 319199 Number of successful extensions: 823 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 823 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1584903024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -